Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5a3-ps Olfactory Receptor

Gene Symbol Or5a3-ps
Organism Rat
Family 5
Subfamily a
Pseudo Yes
Location chr1:228684561-228685361 (+)
Aliases Olr337, Olr337

Sequence information


Nucleotide sequence

ATGGACTCACACCTCCACTCCCCCATGTACTTCTTCCTTAGTAATCTGTCCTTTATTGAT
GTCTCATATACCTCCACCATAGCCCCTAAGATGCTCTGTGACTTTTTTAGGGAGCAGAAG
TCCATCTCTTTCATAGGCTGTGCTATACAGCTTTTCTTCTTTATTGGAATGGGAGGCACT
GAGTGCTGTCTCCTGGCAGCCATGGCATATGACAGATACGCTGCTATCTCCAACCCTCTA
CTTTATCCATCCCTCATGTCACCCACCATCCGTGTAAGGATGGCCATCACAGTATACACA
GGAGGGTTCCTCACTGGCTTGATCCAAACCAGCTCCATATTCCAGCTTCATTTCTGTGGC
TCTCGGGTCATTAATCATTTTTTCTGTGACTTGCCACCCCTGATGTCCTTGTCTTGCTCC
AGCACTTTTTTCAGCCAAGTAGTGAACTTCCTGGTTGTGTGTGTGGTTGGTGGGGCATCA
GCGCTGGTTGTCTTGGTCTCTTATAGCTACATCATTGCTGCTGTCATGAGGATTCATTCA
ACCCGTGGGCAGATGAAGGCTTTCAACACCTGTGCCTCTCATCTGACTACAGTGATCCTT
TTTTATGGCTCTGGTCTCTTCTCATACCTTCATTCTAATGTTGGATACTCACAGGACAAA
AATAAGGTGGTGTCCATGTTCTATGGGGCAGTGATTCCCATGTTGAACCCGATCATATAT
AGTTTGAGAAACAAGGAGATCAGAGAAGCATTGAAGAAACTCAAGAAGAGGAAGAAGCAG
ATGTCCTGTCTCTGTGCTATG


Conceptual translation

MDSHLHSPMYFFLSNLSFIDVSYTSTIAPKMLCDFFREQKSISFIGCAIQLFFFIGMGGT
ECCLLAAMAYDRYAAISNPLLYPSLMSPTIRVRMAITVYTGGFLTGLIQTSSIFQLHFCG
SRVINHFFCDLPPLMSLSCSSTFFSQVVNFLVVCVVGGASALVVLVSYSYIIAAVMRIHS
TRGQMKAFNTCASHLTTVILFYGSGLFSYLHSNVGYSQDKNKVVSMFYGAVIPMLNPIIY
SLRNKEIREALKKLKKRKKQMSCLCAM