Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5a3 Olfactory Receptor

Gene Symbol Or5a3
Organism Mouse
Family 5
Subfamily a
Pseudo No
Location chr19:12422311-12423264 (+)
Aliases Olfr1441, MOR215-2

Sequence information


Nucleotide sequence

ATGGCTGTGGGAAGAAACATTAGCGTGGTGACTAATTTCATCCTTTTGGGATTTTTAGAG
CGTCCCCAGCTGCAGATTGTCCTCTTTGTGTTGTTTCTGGGGATCTACCTGGTGACCCTG
GCTGGAAACTTGGGCCTCATTGTCTTGATCAGGATGGACTCACACCTCCACTCCCCTATG
TACTTCTTCCTTAGTAATCTGTCCTTTGTTGATGTCTCATACACCTCCTCCATAGCCCCT
AAGATGCTCTGTGATTTCTTTAGGGAGCAGAAGTCTATCACCTTTATAGGCTGTGCTATA
CAGCTTTTCTTCTTTGTTGGGATGGGAGGTACTGAGTGCTGTCTCCTGGCAGCCATGGCA
TATGACAGATACGTTGCTATCTCCAACCCTCTACTCTATCCATCCCTCATGTCACCCACC
ATCTGTGTGGGGATGGCCATCACAGTATACACAGGAGGGTTCCTCACTGGCTTGATCCAA
ACTAGCTCCATATTCCGACTTCATTTCTGTGGGCCGCGGGTCATTAATCATTTTTTCTGT
GACTTGCCACCCCTAATGTCCTTGTCTTGCTCTAGCACTTTTTTCAGCCAAGTAGTGAAC
TTCCTGGTTGTGTGTGTGGTTGGTGGGGCATCAGCACTGGTTGTCTTGGTCTCCTATGGC
TACATCATTGCTGCCGTCATGAGGATTCATTCAACCCATGGGCAGATGAAAGCTTTCAAC
ACCTGTGCCTCTTATCTGACTACAGTGATCCTTTTCTATGGCTCTGGTCTCTTCTCATAC
CTCCATTCTAATGCTGGATACTCACAGGACAAAAATAAGGTGGTGTCCATGTTCTATGGT
GCAGTGATTCCCATGTTGAACCCTATCATTTATAGCCTAAGAAATAAGGAGATCAAAGAA
GCATTGAAGAAACTCAAGAAGAGGAAGAAGCAGATGTCCTGTCTCTGTGCTATG


Conceptual translation

MAVGRNISVVTNFILLGFLERPQLQIVLFVLFLGIYLVTLAGNLGLIVLIRMDSHLHSPM
YFFLSNLSFVDVSYTSSIAPKMLCDFFREQKSITFIGCAIQLFFFVGMGGTECCLLAAMA
YDRYVAISNPLLYPSLMSPTICVGMAITVYTGGFLTGLIQTSSIFRLHFCGPRVINHFFC
DLPPLMSLSCSSTFFSQVVNFLVVCVVGGASALVVLVSYGYIIAAVMRIHSTHGQMKAFN
TCASYLTTVILFYGSGLFSYLHSNAGYSQDKNKVVSMFYGAVIPMLNPIIYSLRNKEIKE
ALKKLKKRKKQMSCLCAM