Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5ac19 Olfactory Receptor

Gene Symbol Or5ac19
Organism Rat
Family 5
Subfamily ac
Pseudo No
Location chr11:43281458-43282378 (+)
Aliases Olr1538

Sequence information


Nucleotide sequence

ATGGCTGAAGAAAACCGCACTCTGGTCACTGAGTTTATCCTCACAGGACTCACAGAGCAT
CCCGCACTGAAGGTTGCCCTGTTCCTACTGTTCCTTGTCATCTACCTCATCACCATGGTG
GGAAATCTCGGACTGATTGCTCTCATCTGGAAGGACTCTCACCTCCACACCCCCATGTAC
TTATTCCTCAGCAGCTTGGCTTTTGCTGACTCATGCACTACATCCTCTGTGACTCCCAAA
ATGCTTGTCAACTTTTTATCTGAAAACCATGAGATATCCCCGTTTGAGTGCTTTGCTCAG
TTTTATTTTATGGGTTCCAGTGCAACCACAGAATGCTTTCTCCTATCAGTGATGGCCTAC
GACCGCTATGTGGCCATATGTAACCCTTTGCTCTATCCAGTGTTGATGTCTAACAGACTC
TGTATTCACTTTATAGCTGTGACATACTTACTTGGTGTTCTGCACTTGGCAATTCATGTG
GGTTTGCTATTTAGACTGACTTTCTGCAGATCCAACATTATACAATATTATTACTGTGAA
ATTTTACAACTTTTCAACATTTCTTGCATTGATCCAACTATTAACATGTTTGTGCTTTTA
ATCTTTTCAATTTCTATACAAGCCTTCACCTTTGTAACCATCTTGGTTTCATACATCCAT
GTCCTCTTTGCCATCCTGAGAAAGAAGTCTGAGAAGGGCAGAAGCAAAGCCTTCTCCACA
TGCAGTGCCCACCTGCTTTCTGTCTCTTTGTTCTATGGAACTCTTTTTCTCATTTATGTT
TGTCCTGGGTCTGGACCAGTGGGAGACAAAGAGAAAATGCTTTCTTTATTTTATACAGTA
ATAATCCCCCTTCTCAACCCATTTGTTTACAGTCTGAGGAACAAAGAGGTTATATGTGCT
TTTAGAAGAGTAATGAATAAC


Conceptual translation

MAEENRTLVTEFILTGLTEHPALKVALFLLFLVIYLITMVGNLGLIALIWKDSHLHTPMY
LFLSSLAFADSCTTSSVTPKMLVNFLSENHEISPFECFAQFYFMGSSATTECFLLSVMAY
DRYVAICNPLLYPVLMSNRLCIHFIAVTYLLGVLHLAIHVGLLFRLTFCRSNIIQYYYCE
ILQLFNISCIDPTINMFVLLIFSISIQAFTFVTILVSYIHVLFAILRKKSEKGRSKAFST
CSAHLLSVSLFYGTLFLIYVCPGSGPVGDKEKMLSLFYTVIIPLLNPFVYSLRNKEVICA
FRRVMNN