Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5ac24 Olfactory Receptor

Gene Symbol Or5ac24
Organism Rat
Family 5
Subfamily ac
Pseudo No
Location chr11:43153138-43154055 (+)
Aliases Olr1529

Sequence information


Nucleotide sequence

ATGGAGGTGAACAGCACCCTGCTGACTGAATTTGTTCTCAGAGGAATAACAGATCGTCCA
GAGCTGCAAGTCCCCCTGTTCCTGGTGTTCTTCCTCATCTATGCCACCACCATGGTAGGC
AACCTTGGCTTAATCTTTCTCATCTGGAAGGACCCCCATCTTCACACACCCATGTACCTT
TTCCTTGGAAATTTAGCCTTTGCTGATGCTTGTATTTCAACCACAGTGACACCAAAGATG
CTTATGAAAATTTTAAATAAGAATGACATGATATCCATGGGTGAATGTTTTGCCCAATAT
TATTTTTTTTGTATCAGTGCAACTACTGAAATTTTTCTTCTGGTAGCCATGGCCTATGAC
CGCTATGTAGCCATATGTAACCCTCTGCTCTATCTAGTGGTGATGTCCAAAAGACTCTGC
ACTGTGCTAATCAGTATGTCATATATCATTGGTTTTGTTAACTGTGGGCTTAATATAGGC
TTATTATTTAGATTAACTTTCTGTAAATCCAATGTAATTGACCATTTCTACTGTGAAATC
TTGCAACTCTATACAATTTCTTGCACGGATGCATCTCTTAATTCATTGGTTGTTTTTATT
TGTGCTTCTTCTATACAAATCAGTACCTCTGTGACCATTGTAGTCTCTTATGCCCGTGTC
CTATTTGCTGTCCTGAACATGAAGTCTGAGAAGGGCAGAAGAAAAGCTTTCTTCACCTGC
AGTGCCCACCTGCTCTCTGTCTCTTTGTTCTATGGTACTCTCCTCTTCATGTATGTGAGC
CCTGGGTCTGGGTCAGGTAAACAGAAGGATAAAATGTATTCTCTGTTCTACACAGTTGTG
ATTCCTCTGCTAAATCCCTTCATTTACAGCTTAAGAAACAAGGAAGTCTTGGGTGCTCTG
AAAAAAATTATAAAATGT


Conceptual translation

MEVNSTLLTEFVLRGITDRPELQVPLFLVFFLIYATTMVGNLGLIFLIWKDPHLHTPMYL
FLGNLAFADACISTTVTPKMLMKILNKNDMISMGECFAQYYFFCISATTEIFLLVAMAYD
RYVAICNPLLYLVVMSKRLCTVLISMSYIIGFVNCGLNIGLLFRLTFCKSNVIDHFYCEI
LQLYTISCTDASLNSLVVFICASSIQISTSVTIVVSYARVLFAVLNMKSEKGRRKAFFTC
SAHLLSVSLFYGTLLFMYVSPGSGSGKQKDKMYSLFYTVVIPLLNPFIYSLRNKEVLGAL
KKIIKC