Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5ac25 Olfactory Receptor

Gene Symbol Or5ac25
Organism Rat
Family 5
Subfamily ac
Pseudo No
Location chr11:43143882-43144799 (+)
Aliases Olr1528

Sequence information


Nucleotide sequence

ATGGACCCTCTGAACAGGACCCAGATGACTGAGTTTGTTCTCAGAGGAATAACAGATCGT
CCAGAACTGCAAGTCCCCCTGTTCCTGGTGTTCTTCCTCATCTACGTCACCACCATGGTG
GGCAACCTTGGCTTAATCTTTCTCATCTGGAAGGACCCCCATCTTCACACACCCATGTAC
CTTTTCCTTGGAAATTTAGCCTTTGCCGATGCCTGCACCTCATCTTCTGTGACACCAAAG
ATGCTTATGAAATTTTTAAATAAGAATGACATGATATCCGTGGGTGAGTGTTTTGCCCAA
TTTTATTTTTTTTGTTTCAGTGCGACCACAGAATGCTTCCTCCTGGTAGCGATGGCCTAT
GACCGCTATGTAGCCATATGTAACCCTCTGCTCTATCTAGTGGTGATGTCCAACAGACTC
TGTATTCAGTTCATAACTGTGTCATATCTAATTGGATTTCTACATGGTTTACTTCATGTA
GGATTGTTATTTAGGCTAACCTTTTGTAGTTCCAATGTAATTGATCATTTCTACTGTGAA
ATCCTCCCACTCTATACAATTTCTTGCACTGACCCATCCATCAATGCATTGGTAGCTTTC
ATTATGGCTATTTTTATACAAGTGAATACTTTTATAAGTATTATAGTTTCTTATGCCCGT
GTCCTCTTTGCCATCCTGAGAACAAAGTCTGAGAGGGGCAGAAGAAAAGCCTTCTCCACT
TGCAGTTCCCATCTCTTGTCTGTCTCTTTGTTCTATGGCACTCTCTTCATCATATACGTA
CTCTCTGGCTCTGACACAGATAATTATCAGGGTAAAATGTATTCACTGTTTTACACCATT
ATCATTCCTTTGTTGAACCCCTTCATTTACAGCCTAAGAAACAAAGAAGTCATAGGTGCC
TTGAGAAAACTCACAAAA


Conceptual translation

MDPLNRTQMTEFVLRGITDRPELQVPLFLVFFLIYVTTMVGNLGLIFLIWKDPHLHTPMY
LFLGNLAFADACTSSSVTPKMLMKFLNKNDMISVGECFAQFYFFCFSATTECFLLVAMAY
DRYVAICNPLLYLVVMSNRLCIQFITVSYLIGFLHGLLHVGLLFRLTFCSSNVIDHFYCE
ILPLYTISCTDPSINALVAFIMAIFIQVNTFISIIVSYARVLFAILRTKSERGRRKAFST
CSSHLLSVSLFYGTLFIIYVLSGSDTDNYQGKMYSLFYTIIIPLLNPFIYSLRNKEVIGA
LRKLTK