Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5af1b Olfactory Receptor

Gene Symbol Or5af1b
Organism Rat
Family 5
Subfamily af
Pseudo No
Location chr10:44749541-44750464 (-)
Aliases Olr1457

Sequence information


Nucleotide sequence

ATGTCCAACCACACAACAGTGACCCACTTCATCCTCAGGGGCTTCTCCGATGTCCCACAG
CTGAGATTGGTGGTCATCCCATTTTTCTTGCTTGTTTACACATTTGGCCTCCTGGGGAAC
TTCTCCATCATCATGGCTGTGAGGAGAGACAGTAGGCTCCACTCTCCCATGTACTTCTTC
CTGAAGAACTTGTCTTTCCTGGACATGTGCTACACCTCAGCCACCATCCCCAAGGCAGTG
GCTATATCCTTCACAGGCTCAGGGGTCGTCTCCTATCTCGAGTGTGTAGCACAACTTTAC
ATAATTTTTACATTTGCATGTACTGAATGCTTCCTGCTCACAGCCATGGCTTATGACCGG
TGCCTGGCCATCCTCAGACCACTGCTCTATGGAACCATCATGAGCCAGAAATATTGTCAT
GCGTTAGTGGTCACTGCCTGGGTGAGTGGGGCCATCTACTCAGCCTTCCATACTTCCAAC
ACTTTCTCCCTCCCCTACTGTGGACCCAATGTTGTTGAACACTTCTTCTGTGACATGCCT
GCAATCATGAGACTCTCCTGTACTGATTACCATCTCACGGAGGACGTGGGCTTTGCTGTT
AGCAGCTGTGTTGTCATGAGTTCCTTGGCCCTCACAGTGGTCTCCTATATTGGCATTGTG
GCCACAGTTCTTCGCATCCCCTCAGTGGATGGCAGGTGGAAAGCCTTTTCTACTTGCTCC
TCTCACCTGACCACGGTCATCTTGTTTTATGGAACTGGAAGCTTTGTGTACCTGAGGCCT
GCCTCTCACTACTCCCCAACCCTGGGTCGCCTGGCATCCATTTTCTACTCTGTAGTCACA
CCATCTTTGAATCCAGTTGTCTATTGTCTGAGGAACAAAGATATGAAGTTTGCTCTACAG
AAACTTTATTGTGGGAGGAAGTAC


Conceptual translation

MSNHTTVTHFILRGFSDVPQLRLVVIPFFLLVYTFGLLGNFSIIMAVRRDSRLHSPMYFF
LKNLSFLDMCYTSATIPKAVAISFTGSGVVSYLECVAQLYIIFTFACTECFLLTAMAYDR
CLAILRPLLYGTIMSQKYCHALVVTAWVSGAIYSAFHTSNTFSLPYCGPNVVEHFFCDMP
AIMRLSCTDYHLTEDVGFAVSSCVVMSSLALTVVSYIGIVATVLRIPSVDGRWKAFSTCS
SHLTTVILFYGTGSFVYLRPASHYSPTLGRLASIFYSVVTPSLNPVVYCLRNKDMKFALQ
KLYCGRKY