Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5ag1-ps Olfactory Receptor

Gene Symbol Or5ag1-ps
Organism Mouse
Family 5
Subfamily ag
Pseudo Yes
Location chr7:108476864-108477407 (-)
Aliases Olfr499-ps1

Sequence information


Nucleotide sequence

ATGGAGCCTAGAGTCCACAGTACCTTGATAGAGTTCATCCTATAAAGGTTAACAGACAAG
CTTGTTCTTTGTTTCATCATCCTTTTGCATTTTCTTGGAATATGCATTCTCAGTTTACTA
GCATAATCAATTTAGTAAGAAGCTGTCTCCAGCTCCATAGTACTGTTATTGGAGTCAACC
TCTATATTGCTTCTTAGCCATCTGGCTTTTATGAATCTTGCCTATTCCAAAGCAATTACA
CCTATAATGCTGAAGGTATTCATTGTACATGGAACAGCACTTCCTGTGCATGTCCATGAA
GCCTAGATATGTTCTGTGTTGACTTTTGTGACAGCAGAGTGCTTTCTGCTAGCTGACATG
ATCTATGATGTCTATATGGCCATCTGCTTATCCCTAAACTATCCCATACATATATATGTT
TCACAAATCTGCCTCCTCTTAGTTGGACTTCTTAAGTTACTGGCAATGTGAGTACTGGAA
AACTTACCTGTTCTTAAGTCTGTACTTCTGTGAATCAAATCAGATAGCTCTCTCCTGTGA
TGTC


Conceptual translation

MEPRVHSTLIEFIL*RLTDKLVLCFIILLHFLGICILSLLA*SI**EAVSSSIVLLLEST
SILLLSHLAFMNLAYSKAITPIMLKVFIVHGTALPVHVHEA*ICSVLTFVTAECFLLADM
IYDVYMAICLSLNYPIHIYVSQICLLLVG/S*VTGNVST/KTYLFLSLYFCESNQIAL
SCDV