Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5ak22 Olfactory Receptor

Gene Symbol Or5ak22
Organism Mouse
Family 5
Subfamily ak
Pseudo No
Location chr2:85,399,600-85,400,500 (-)
Aliases Olfr992

Sequence information


Nucleotide sequence

MKHSNDSKVTEFILLGFAGQNESWHILFVVFLVIYIATLVGNIGMILLIKLHSSLHTPMY
FFLQHLAFVDLCYSSAITPRTLQNFVSTKPSISFTGCLAQLLVYGIFVTSDCFILAAMAV
DRYVAICNPLRYPIIMSQRLCILLLLGSYTMGFLNATVNTGFTFLSNFCKSNVINHFFCD
VPPILALSCSSIDLNIMVLTIFVGFNLTFTVSVVILSYTFILAAILRMSSASGRRKAFST
CASHMTAVTIFYGTLSYMYVLHGTNRSQEQEKVASVFYGIMIPMLNPLIYSLRNQDVIEA
LRHIGNKCF


Conceptual translation

MKHSNDSKVTEFILLGFAGQNESWHILFVVFLVIYIATLVGNIGMILLIKLHSSLHTPMY
FFLQHLAFVDLCYSSAITPRTLQNFVSTKPSISFTGCLAQLLVYGIFVTSDCFILAAMAV
DRYVAICNPLRYPIIMSQRLCILLLLGSYTMGFLNATVNTGFTFLSNFCKSNVINHFFCD
VPPILALSCSSIDLNIMVLTIFVGFNLTFTVSVVILSYTFILAAILRMSSASGRRKAFST
CASHMTAVTIFYGTLSYMYVLHGTNRSQEQEKVASVFYGIMIPMLNPLIYSLRNQDVIEA
LRHIGNKCF