Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5ak23 Olfactory Receptor

Gene Symbol Or5ak23
Organism Mouse
Family 5
Subfamily ak
Pseudo No
Location chr2:85413936-85414877 (-)
Aliases Olfr993, RP23-429P18.1, MOR203-2, RP23-429P18.1, MOR203-2

Sequence information


Nucleotide sequence

ATGATACAATACAATGAGACTGAAGTCAAGGGCTTCTATCTCCTGGGATTTGGAGTCCAA
CATGATATTCAGTGTTTCCTCTTCATTGTGTTTCTTATCATTTACATGACATCCATGGTG
GGTAACACTGGGATGATTCTTCTAATCCACACTGACTCCAGACTTCAGACCCCCATGTAC
TTCTTCCTACAACATCTGGCCTTTGTTGATATCTGTTATACATCTGCTATTACTCCCAAG
ATGCTACAAACCTTTGTAGTAGAAGACAGATACATATCATTTGGAGGATGTGTAGTGCAA
TTACTGATCTACGCAATCTTTGCTACTTGTGACTGTTATCTCCTGGCAGCTATGGCAGTG
GACCGCTATGTAGCCATCTGCAAACCACTTCGTTATCCCATACTCATGTCCCGAAAAGTC
TGCATCCAGATGGTAGCTGGCTCCTATCTCATTGGATCAATAAATTCTTCAGTACACACA
GGCTTTACATTTTCATTGTCATACTGTAAATCTAATCACATCAATCACTTTTTCTGTGAT
GTGCCCCCAATTATTAGCCTTTCCTGCTCCAACATTGAGACCAATATCAAGATTCTTGTT
ATCTTTGTTGGATTTAACCTGATATTCACTGTGCTGGTTGTTATCTTCTCCTACATGTAC
ATCATGGCTGCCATCTTAAAGATGTCCTCTACTGCAGGGAGGAAGAAAACCTTCTCCACG
TGTGCCTCCCACCTGACAGCAGTCACCATCTTCTATGGAACCCTTGCTTACATGTACTTA
CAGCCTCATTCGGACAATTCCGAGGAGAATATGAAAGTGGCCTCTGTGTTTTATGGCATT
GTGATTCCCATGCTGAATCCTCTGATCTACAGCCTGAGAAACAAGGAGGTCAAAGATGCT
ATAAAATTGACAAAGAAAAAGTTATTTAGATTTGACACACAA


Conceptual translation

MIQYNETEVKGFYLLGFGVQHDIQCFLFIVFLIIYMTSMVGNTGMILLIHTDSRLQTPMY
FFLQHLAFVDICYTSAITPKMLQTFVVEDRYISFGGCVVQLLIYAIFATCDCYLLAAMAV
DRYVAICKPLRYPILMSRKVCIQMVAGSYLIGSINSSVHTGFTFSLSYCKSNHINHFFCD
VPPIISLSCSNIETNIKILVIFVGFNLIFTVLVVIFSYMYIMAAILKMSSTAGRKKTFST
CASHLTAVTIFYGTLAYMYLQPHSDNSEENMKVASVFYGIVIPMLNPLIYSLRNKEVKDA
IKLTKKKLFRFDTQ