Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5ak24 Olfactory Receptor

Gene Symbol Or5ak24
Organism Mouse
Family 5
Subfamily ak
Pseudo No
Location chr2:85429886-85430827 (-)
Aliases Olfr994, RP23-429P18.2, MOR203-4, RP23-429P18.2, MOR203-4

Sequence information


Nucleotide sequence

ATGACACAAGGCAATGGCACTGAAGTCACTGACTTCTATCTTCTGGGATTTGGAGTTGAG
AGAGATATTCAGTGTGTCCTCTTCATTGTGTTCCTTGTTATTTATGTGACATCCATGGTG
GGCAACACTGGGATGATCCTCCTTATCAACACTGACTCCAGACTTCAGACTCCCATGTAC
TTCTTCCTACAACATCTGGCTTTTGTTGATATCTGCTACACATCTGCCATCACTCCCAAG
ATGCTGCAGAATTTCATGGTCGAAGATAAATCAATAACTTTTAAGGGATGTGTAATACAA
TTATTTATTTATGCTGTATTTGCAACCAGTGACTGTTATCTCCTCGCTGTTATGGCAGTG
GACCGGTATGTGGCAATCTGTAAGCCCCTTCGCTACCCCATAATCATGTCTCGGCAAGTC
TGTGTTCAGTTGGTAGCTGTTTCTTATCTCATGGGATCAATAAATTCCTCTGTACACACA
GGATTTACATTTTCACTGTCCTTCTGTGCATCAAAAATCAATCACTTTTTCTGTGACATT
CCGCCAATTGTCACTCTTTCATGCTACAACAATGACATTAATTTCATGCTAATTTTGATT
TTTGTTGGATTTAACCTAACATTCACTGTGTCAGTTGTTATCTTATCATACATATACATC
ATGGCCGCCATCCTAAAGATGTCCTCTACTGCAGGGAGGAAGAAAACCTTCTCCACGTGT
GCCTCCCACCTGACAGCAGTCACCATCTTCTATGGAACCCTTGCTTACATGTACTTACAG
CCTCCTTCAGACAATTCCGAGGAGAATATGAAAGTGGCCTCTGTGTTTTATGGCATTGTG
ATTCCCATGCTAAATCCTCTGATCTACAGCCTGAGAAACAAGGAAGTCAAAGATGCTATT
AAAGCTACAGGGAAAAAGTTCCTTAAATTGGATTTAAATTAC


Conceptual translation

MTQGNGTEVTDFYLLGFGVERDIQCVLFIVFLVIYVTSMVGNTGMILLINTDSRLQTPMY
FFLQHLAFVDICYTSAITPKMLQNFMVEDKSITFKGCVIQLFIYAVFATSDCYLLAVMAV
DRYVAICKPLRYPIIMSRQVCVQLVAVSYLMGSINSSVHTGFTFSLSFCASKINHFFCDI
PPIVTLSCYNNDINFMLILIFVGFNLTFTVSVVILSYIYIMAAILKMSSTAGRKKTFSTC
ASHLTAVTIFYGTLAYMYLQPPSDNSEENMKVASVFYGIVIPMLNPLIYSLRNKEVKDAI
KATGKKFLKLDLNY