Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5ak25 Olfactory Receptor

Gene Symbol Or5ak25
Organism Mouse
Family 5
Subfamily ak
Pseudo No
Location chr2:85438212-85439156 (-)
Aliases Olfr995, RP23-429P18.3, MOR203-3, RP23-429P18.3, MOR203-3

Sequence information


Nucleotide sequence

ATGATACAAAGAAATACCACTGAAGTCACTGACTTCTATCTTCTGGGATTTGGAGTCCAG
AAAAATACTCAGAGTATCCTCTTCGTTGTATTTCTTGTGGTCTATGTAACATCCATGGTG
GGCAACACTGGGATGATCCTCCTCATTAACACTAACTCCAGACTTCAGACTCCTATGTAC
TTCTTCTTACAAAACCTGGCTTTTGTTGATATCTGTTACACATCTGCCATCACTCCCAAG
ATGCTACAGAACTTCATGGTAGAAGACAGTTCCATATCATATACAGGATGTGTAATACAA
TTGTTGGTCTATGCCACATTTGCGACCAGTGACTGTTACCTCCTCGCTGTTATGGCAGTG
GACCGGTATGTGGCAATCTGTAAGCCCCTTCGCTACCCCATAATCATGTCTCGACAAGTT
TGTGTTCAGTTGGTAGCTTTTTCTTATCTCATGGGATCAATAAATTCCTCTGTACACACA
GGATTTACATTCTCATTGTCTTATTGTAATTCCAAAAATATCAATCACTTTTTCTGTGAT
GTTGTCCCAATCATCAGCCTTTCATGCTCCAACATTGATATTAATATCATGCTTCTTGTT
ATTTTTGTTGGATTTAACCTGACGTTCACTGTGTTGGTCATTATCTTCTCCTACATATAC
ATCATGGCCGCCATCCTAAAGATGTCCTCTACTGCAGGGAGGAAGAAAACCTTCTCCACG
TGTGCCTCCCACCTGACAGCAGTCACCATCTTCTATGGAACCCTTGCTTACATGTACTTA
CAGCCTCATTCGGACAATTCCGAGGAGAATATGAAAGTGGCCTCTGTGTTTTATGGCATT
GTGATTCCCATGCTGAATCCTCTGATCTACAGCCTGAGAAACAAGGAGGTCAAAGAAGGT
TTTAAAGCAATGAGCAGAAGGTTCTTAAGATTGAAATCAAATCCT


Conceptual translation

MIQRNTTEVTDFYLLGFGVQKNTQSILFVVFLVVYVTSMVGNTGMILLINTNSRLQTPMY
FFLQNLAFVDICYTSAITPKMLQNFMVEDSSISYTGCVIQLLVYATFATSDCYLLAVMAV
DRYVAICKPLRYPIIMSRQVCVQLVAFSYLMGSINSSVHTGFTFSLSYCNSKNINHFFCD
VVPIISLSCSNIDINIMLLVIFVGFNLTFTVLVIIFSYIYIMAAILKMSSTAGRKKTFST
CASHLTAVTIFYGTLAYMYLQPHSDNSEENMKVASVFYGIVIPMLNPLIYSLRNKEVKEG
FKAMSRRFLRLKSNP