Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5ak26-ps Olfactory Receptor

Gene Symbol Or5ak26-ps
Organism Rat
Family 5
Subfamily ak
Pseudo Yes
Location chr3:72,760,600-72,761,700 (-)
Aliases Olr438-ps

Sequence information


Conceptual translation

MEHSNNTIVTEFIFVGFTGQNESLHILFVVFLVIYAVTSVSISMTLLIKLHFSLHVPM*F
FL*HLAFVDHCYSSAIIPRMFQNFMSTKPSTSCTGCAMQLYVY/TFITSDCFILDAMTV
DHYVAICNPQHYPFIMSQRLCILMLLCAYTIGFLYASVKTSFTFFPSIC/TQR/CHFF
SDVPP/ALSCSSIDFNIVLLTIFMGFNLSFSVSIV/FSYTCILTAILRMFSAAGRIKA
FSICVTH/SQLVIYGMVGYMYVFHGINRSQEQGKVTFVFYFIIIPMLNLLLYRLRNQDV
IEALRHTGNKLL