Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5al1 Olfactory Receptor

Gene Symbol Or5al1
Organism Rat
Family 5
Subfamily al
Pseudo No
Location chr3:73474670-73475608 (-)
Aliases Olr480, Olr480

Sequence information


Nucleotide sequence

ATGGTTAAGAGCAATCACTCTGCAGTGTCTGAGTTCGTCCTTGTGGGGCTCACAGACGAC
CCCAAGCTTCAGGTCAGTCTCTTCGGTGTGTTTCTAGTCATCTACTTAACTAGTGTTGTA
GGTAATATTGGATTGATTGTGTTAATTCAGGTGAGTCCTCAGCTTCATACACCCATGTAT
TTCTTCCTGACCCATCTGGCTTTTATTGACTTTTGTTTTACTTCTTCTGTCACTCCAAAC
ACTCTATTAAATTTTCTACGTGAAGTTAAAAGCATAACCTTCTATGCATGTGCCACTCAG
TTGTGCTGCTTTGTCACTTTTGTAGTTTGTGAACTGTACTTGCTGTCAATCATGGCCTAT
GACAGGTATGTGGCCATCTGGAACCCTCTCCTCTATGCAGTCCTCATGCCTAGGAAGCTC
TGTCTTCAGGTCATCGCCAGCACATACATTTATGGATTCACTGTTGGACTTGCACAGGCA
GTGGAGACCTTCCGCTTGTCTTTTTGTGGCTCCAATGTAGTTAACCACTTCTACTGTGAT
GATGTTCCCTTAGTTGCTCTGGCCTGTTCTGACACTCATGTCAAAGAGCTGATGTTGCTA
ATCATTGCGGGCTTCAACACCCTTTGCTCTCTGGTGATTGTGGTCATTTCTTACATCTGT
ATTGTCTTTGCCATCCTGAGGATTCATTCTGCTGAAGGAAGAAGGAAAGCCTTTTCCACC
TGTGCATCCCACCTGACTTCTATCACCATATTTTATGGAACAGTTAGTTTTATGTACCTG
CAGCCCAAGTCAAGCCATTCTCTGAACACAGATAAATTTGCTTCTGTGTTTTATGTGGTA
GTAATTCCCATGTTAAACCCACTGATCTACAGCTTGAGAAATCAGGAGGTAAAAAGTGCT
CTGAAGAAAATTGTAGAAAAGTTAACTTTAGCGATCAAG


Conceptual translation

MVKSNHSAVSEFVLVGLTDDPKLQVSLFGVFLVIYLTSVVGNIGLIVLIQVSPQLHTPMY
FFLTHLAFIDFCFTSSVTPNTLLNFLREVKSITFYACATQLCCFVTFVVCELYLLSIMAY
DRYVAIWNPLLYAVLMPRKLCLQVIASTYIYGFTVGLAQAVETFRLSFCGSNVVNHFYCD
DVPLVALACSDTHVKELMLLIIAGFNTLCSLVIVVISYICIVFAILRIHSAEGRRKAFST
CASHLTSITIFYGTVSFMYLQPKSSHSLNTDKFASVFYVVVIPMLNPLIYSLRNQEVKSA
LKKIVEKLTLAIK