Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5al5-ps Olfactory Receptor

Gene Symbol Or5al5-ps
Organism Rat
Family 5
Subfamily al
Pseudo Yes
Location chr3:73,437,900-73,438,800 (-)
Aliases Olr478-ps

Sequence information


Nucleotide sequence

TTTGCTGTGTTTCTAGTCATCTACTTAACTACTGTCTTGGGGAATCTAGGACTGATTATG
TTAATCCACTTCAGCCCTCAGATTCATACACCCATGTACTTTTTCCTCAGTCACTTTGCT
TTTGTTGATTTCTGTTATACATCCTCAGTTACTCCAAACACAATTATAAACTTCCTTCGA
GAAGTCAAAAGTATAACCTTCTATGCATGTGCCACTCAGGTGTGCTGTTTCATCACATTT
GCTGTTTGTGAAATGTACTTGCTGTCAGTCATGGCCTGTGACATGTATGTGGCCATCTGG
AACCCTCTCCTCTATGCGGTCCTCATGCCTAGGAAGCTCTGTCTTCAGGTCATCGCCAGC
ACATACATTTATGGATTCACTGTGGGGCTTGCTGAGGCAGTGGCAACCTTCCACTTGTCT
TTCTGTGGCTCCAATGTTGTCAACCATTTCTACTGTGATGATGTCCCCTTGGTTGCTCTC
GCCTGTTCTGACACTCGTGTCAAAGAGCTGATGTTGCTAATCATTTCTGCCTTCAACATA
CTCTGTTCTCTGGTGGTTGTGGTTACTTCATATATCTTCATCATTTTTGCCATCCTGAGG
ATTCATTCTGCTGAAGGAAGAAAAAAAGCCTTTTCTACTTGTGCTTCCCACCTGACTTCA
ATCACCATATTTTATGGGACAATCATTTTTATGTACCTGCAACCCAAGTCAAGCCATTCT
CTAAACACAGATAAAATTGCTTCTGTGTTTTATGTAGTAGTAATTCCCATGTTAAACCCA
TTAATCTACAGCTTAAGAAATCAGGAGGTAAAAAATGCCCTGAAGCGATTTTCTGATAAA
TTGTCTTTGACCATC


Conceptual translation

MAEGNSSTVSQFIFVGLTDDPELEII/FAVFLVIYLTTVLGNLGLIMLIHFSPQIHTPM
YFFLSHFAFVDFCYTSSVTPNTIINFLREVKSITFYACATQVCCFITFAVCEMYLLSVMA
CDMYVAIWNPLLYAVLMPRKLCLQVIASTYIYGFTVGLAEAVATFHLSFCGSNVVNHFYC
DDVPLVALACSDTRVKELMLLIISAFNILCSLVVVVTSYIFIIFAILRIHSAEGRKKAFS
TCASHLTSITIFYGTIIFMYLQPKSSHSLNTDKIASVFYVVVIPMLNPLIYSLRNQEVKN
ALKRFSDKLSLTI