Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5al5 Olfactory Receptor

Gene Symbol Or5al5
Organism Mouse
Family 5
Subfamily al
Pseudo No
Location chr2:86130705-86131661 (-)
Aliases Olfr1039, RP23-232A21.2, MOR185-5, MOR185-9P, Olfr1517, RP23-232A21.2, MOR185-5, MOR185-9P, Olfr1517

Sequence information


Nucleotide sequence

ATGGCTGAAGGTAACAGTTCAACAGTATTTCAGTTCATTCTTGAAGGCCTGACAGATGAC
CCAGAGCTTGAGGTCACCCTCTTTGCTGTGTTTCTAGTCATCTACTTAACTACTGTCTTG
GGTAACCTAGGACTGATTATGCTAATCCAAGTCAGCCCTCAGCTTCACACACCCATGTAC
TTTTTCCTCTGCCACTTGGCATTCGTTGATTTCTGTTATACATCCTCAGTCACTCCAAAC
ACAATTATAAACTTTCTTCGAGAAATCAAAAGTATAACCTTCTATGCATGTGCCACTCAG
GTTTGCTGTTTCATCACATTTGCTGTTTGTGAAATGTACTTGCTGTCAGTAATGGCTTAT
GACAGATATGTGGCCATCTGGAACCCCCTCCTCTATGTGGTCCTCATGCCTAAAAAGCTC
TGTCTTCAGGTCATCACCAGCACATACATTTATGGATTCACTGTGGGGCTTGCACAGGCA
GTGGCAACTTTCCGCTTGTCTTTCTGTGGCTCCAATGTGATCAACCACTTCTACTGTGAT
GATGTCCCCTTAGTTGCTCTGGCCTGTTCTGACACTCATGTCAAAGAGCTGATGTTGCTA
ATCATTGCTGGCTTCAACACTCTTTGCTCTCTGGTGATTGTGGTTATTTCTTACATCTGC
ATTCTCTTTGCCATCCTGAGGATTCATTCTGCTGAAGGAAGAAGGAAAGCCTTTTCCACT
TGTGCATCCCACCTGACTTCCATCACCATATTTTATGGAACAATCATTTTTATGTACCTG
CAGCCCAAGTCAAGCCATTCTCTGAACACAGATAAATTTGTTTCTGTGTTTTACGTGGTA
GTAATTCCCATGTTAAATCCGCTGATCTATAGTTTGAGAAATAAGGAGGTTAAAAATGCC
CTGAAGCGATTTACTGAAAAATTGTCTTTGACCATCCATGATTCCAGAAAGTCTGAG


Conceptual translation

MAEGNSSTVFQFILEGLTDDPELEVTLFAVFLVIYLTTVLGNLGLIMLIQVSPQLHTPMY
FFLCHLAFVDFCYTSSVTPNTIINFLREIKSITFYACATQVCCFITFAVCEMYLLSVMAY
DRYVAIWNPLLYVVLMPKKLCLQVITSTYIYGFTVGLAQAVATFRLSFCGSNVINHFYCD
DVPLVALACSDTHVKELMLLIIAGFNTLCSLVIVVISYICILFAILRIHSAEGRRKAFST
CASHLTSITIFYGTIIFMYLQPKSSHSLNTDKFVSVFYVVVIPMLNPLIYSLRNKEVKNA
LKRFTEKLSLTIHDSRKSE