Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5al6 Olfactory Receptor

Gene Symbol Or5al6
Organism Mouse
Family 5
Subfamily al
Pseudo No
Location chr2:86145794-86146732 (-)
Aliases Olfr1040, RP23-232A21.3, MOR185-12

Sequence information


Nucleotide sequence

ATGGATGAAGATAACAATTCAACAGTACATCAGTTCATCCTCGTAGGCCTGACAGATGAC
CCAGAGCTTGAGGTCATCCTCTTTGCTGTGTTTCTGGTCATCTACTTAACTACTGTCTTG
GGTAACCTAGGACTGATTATGCTAATCCAAGTCAGCCCTCAGCTTCACACACCCATGTAC
TTTTTCCTCTGCCACTTGGCATTCGTTGATTTCTGTTATACATCCTCAGTCACTCCAAGC
ACAATTATAAACTTTCTTCGAGAAATCAAAAGTATAACCTTCTATGCATGTGCCACTCAG
GTTTGCTGTTTTATCACATTTGTTGTTTGTGAAATGTACTTGCTGTCAGTAATGGCTTAT
GACAGATATGTGGCCATCTGGAACCCTCTGCTCTATGTGGTCCTCATGCCTAAAAAGCTC
TGTCTTCAGGTCATTGCTAGCACATACATTTATGGATTCACTGTGGGGCTTGTTCAGGCA
GTGGCAACCTTCCACTTCTCATTCTGTGGCTCTAATGTGATCAACCATTTCTACTGTGAT
GATGTCCCCTTAATTGCTCTTGCCTGTTCTGACACTCATGTCAAAGAGCTGATGTTGCTA
ATCATTGCTGGCTTCAACACTCTTTGCTCTCTGGTGATTGTGGTCATTTCTTACATCTGC
ATTCTCTTTGCCATCCTGAGAATTCGTTCTGTTGAAGGAAGAAGGAAAGCCTTTTCCACT
TGTGCATCCCATCTGACTTCCATCACCATATTTTATGGAACAGTAAGTTTTATGTACCTG
CAGCCCAAGTCAAGCCATTCTCTGAACACAGATAAATTTGCTTCTGTGTCTTATGTGGTA
GTAATTCCCATGTTAAACCCACTGATCTACAGCTTGAGAAATCAGGAGGTAAAAAGTGCC
TTAAAGAGAATTACTGATAAATTGTCTTTGACCATCCAT


Conceptual translation

MDEDNNSTVHQFILVGLTDDPELEVILFAVFLVIYLTTVLGNLGLIMLIQVSPQLHTPMY
FFLCHLAFVDFCYTSSVTPSTIINFLREIKSITFYACATQVCCFITFVVCEMYLLSVMAY
DRYVAIWNPLLYVVLMPKKLCLQVIASTYIYGFTVGLVQAVATFHFSFCGSNVINHFYCD
DVPLIALACSDTHVKELMLLIIAGFNTLCSLVIVVISYICILFAILRIRSVEGRRKAFST
CASHLTSITIFYGTVSFMYLQPKSSHSLNTDKFASVSYVVVIPMLNPLIYSLRNQEVKSA
LKRITDKLSLTIH