Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5al7 Olfactory Receptor

Gene Symbol Or5al7
Organism Rat
Family 5
Subfamily al
Pseudo No
Location chr3:73483735-73484676 (-)
Aliases Olr481, Olr481

Sequence information


Nucleotide sequence

ATGGCCAAAGGCAACCATTCATCAGTGACAGAGTTCATCCTCCTGGGGCTTACAGAAGAT
CCTGAACTTCAGATCATTCTCTTTGTAATTCTTCTAATCATCTACTTGTTTAGTGTCATG
AGTAACCTAGGATTGGTTGTGTTAATACAAATCAGCCCACAGCTTCAGTCCCCAATGTAT
TTTTTCCTCAGCCATCTGGCTTTTGTTGATTTTTGTTATACCTCCTGTGTCACACCAAAT
GCTCTGGTAAATTTTTTGCGTGAGATTAAAAGCATATCATTTTATGGATGTGCAGCTCAA
GTATGTTTCTTCACCACATTTTCTGTGTGTGAAGTCTTCCTGCTGTCTGTAATGGCCTAT
GATAGGTATGTGGCCATCTGCAACCCTTTGCTCTATGTAATTCTCATGCCAAGGAGACTC
TGCATTCAAATAGCCATTACCACGTACATTTACGCATTTGTCACAGCACTTATTCAGACA
GTGACCACATTCATTTTATCTTTTTGTGACTCCAACCTAGTGAACCAGTTCTTCTGTGAA
GACATTCCTCTTATGGCTTTAGCTTGCTCCAACACTCAAGTCAAGGAGCTAATGCTGCTG
AGCATGGCTGGGTTCAATGTGTGCTGCTCTCTCCTCATTGTTCTCATCTCCTATTTGTTC
ATCGTGTCTGCAATTCTGAAGAAACATTCCGGTGAAGGGAGGCAGAAAGTCTTCTCCACC
TGTGCCTCTCACTTGTCTTCTATTGCCATATACTATGGGACAATCATTTTCATGTACTTG
CAACCAGAATCGAGCCATTCCCTAAATACAGACAAATTTGCTGCTGTTTTTTATGTTGTG
GTGATCCCCATGCTAAACCCATTAATTTATAGCTTAAGGAATAAGGAGGTTAAAAATGCT
TTGAAGAAAAGTATAGATAAGATTCCTATAAATATTAGTAAG


Conceptual translation

MAKGNHSSVTEFILLGLTEDPELQIILFVILLIIYLFSVMSNLGLVVLIQISPQLQSPMY
FFLSHLAFVDFCYTSCVTPNALVNFLREIKSISFYGCAAQVCFFTTFSVCEVFLLSVMAY
DRYVAICNPLLYVILMPRRLCIQIAITTYIYAFVTALIQTVTTFILSFCDSNLVNQFFCE
DIPLMALACSNTQVKELMLLSMAGFNVCCSLLIVLISYLFIVSAILKKHSGEGRQKVFST
CASHLSSIAIYYGTIIFMYLQPESSHSLNTDKFAAVFYVVVIPMLNPLIYSLRNKEVKNA
LKKSIDKIPINISK