Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5an1 Olfactory Receptor

Gene Symbol Or5an1
Organism Rat
Family 5
Subfamily an
Pseudo No
Location chr1:228628274-228629209 (+)
Aliases Olr330, Olr330

Sequence information


Nucleotide sequence

ATGATTGGGGGAAGAAACATTACCAAGATCACCCAATTCATCCTCCTGGGATTCTCCGAT
TTCCCCCAAATCACAGCACTGCTCTTTGTTATATTCCTCATCCTTTATCTTATAGCACTG
ACCTGGAACCTGTCCCTTATTGTTTTAATAAGGATGGACTCCTACCTCCACACACCTATG
TACTTCTTCCTCAGCAATCTGTCCTTTATAGACTTCTGCTATATCACCTCTACAGTCCCA
AAGATGCTTTCCAACTTCTTCCAGGAAAAGCAAACTATCAGTTTTGTGGACTGTATTGTT
CAATACTTTATCTTTTCCACTATGGGACTGACTGAATCTTGCCTCATAACAGCCATGACC
TATGACAGGTATGCTGCCATTTGTAACCCTCTTCTCTACTCATCAATCATGTCACCCAGC
CTCTGCTCTTGGATGCTCTTGGGAAGCTATACAGCAGGACTCATAAGTTCTTTATGTCAG
ATATGTGTCTTGCTGCAGCTCCACTTCTGTGGATCTAATGTCATAAGACATTTCTTCTGT
GACATGCCCCAGCTGTTAAATCTATCTTGCAACGACAATTTCTTTGCTCATGTCCTACTT
GTCTTATTAACAATATTTTTTGGGCTTACCAATGCCTTCGTCATCATGGTATCCTACGGC
TATATTGTCTCATCCATCATGAAGATCACTTCAGCGAAGGGCAGGTCCAAGGCCTTCAAC
ACTTGTGCTTCTCACCTGACAACTGTTTCTCTTTTCTATAGTTCTGGCATCTTTGTCTAT
CTGAGTTCTAGCTCTGGTGGCTCCTCCAGCTTTGACAGATTTGCATCTGTCTTCTATACT
GTGGTGATTCCCATGTTGAACCCTTTGATATATAGTCTGAGAAACAAGGAAATCAAAGAT
GCCATGAATAGGTTGCAGAAAAAGGCAACCTGCAGC


Conceptual translation

MIGGRNITKITQFILLGFSDFPQITALLFVIFLILYLIALTWNLSLIVLIRMDSYLHTPM
YFFLSNLSFIDFCYITSTVPKMLSNFFQEKQTISFVDCIVQYFIFSTMGLTESCLITAMT
YDRYAAICNPLLYSSIMSPSLCSWMLLGSYTAGLISSLCQICVLLQLHFCGSNVIRHFFC
DMPQLLNLSCNDNFFAHVLLVLLTIFFGLTNAFVIMVSYGYIVSSIMKITSAKGRSKAFN
TCASHLTTVSLFYSSGIFVYLSSSSGGSSSFDRFASVFYTVVIPMLNPLIYSLRNKEIKD
AMNRLQKKATCS