Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5an10-ps Olfactory Receptor

Gene Symbol Or5an10-ps
Organism Rat
Family 5
Subfamily an
Pseudo Yes
Location chr1:229480173-229481119 (+)
Aliases Olr331, Olr331

Sequence information


Nucleotide sequence

ATGGAAGCAATATTAAAGGAAAAAACATTACTGAGATCACCCAGTTCATCCTCCTGGGAT
TTTCCGATTTCCACCAAATCACAGCACTGCTCTTTGTTATATTCCTCACCCTGTATATTA
CAGCACTGACCTGGAACCTGTCCCTTATTGTTTTAATAAGGATGGACTCCTACCTCCACA
CACCTATGTACTTCTTCCTCAGCAATCTGTCCTTTATTGACCTCTGCTATATCACTTCTA
CAGTCCCAAAGATGCTTTCCAACTTCTTCCAGGAAATGCAAACTATCAGCTTTGTGGGCT
GCATTGTTCAATACTTTATCTTTTCCACTATGGGGCTGACTGAATCTTGCCTCATGACAG
CCATGGCCTATGACAGGTATGCTGCCATTTGTAACCCTCTTCTCTACTCATCAATCATGT
CACCCAGTCTCTGTGCTCGGATGCTCTTGGGAAGCTATACAGCAGGACTTGTGGGTTCTG
TATCTCAGGTGTGTGCCTTGCTGCAGCTCCATTTCTGTGGACCTAATGTCATCAGACATT
TCTTCTGTGACATGCCTCAGCTATTAAATCTATCCTGCATTGATACTCTTTTTGCACAGG
TCCTTCTTGCTGTATTAACAACATTATTTGGTTTTTCAAATGCCTTAGCCATCATGATAT
CCTATGGCCATATTATCTTGTCCATCATGAAGATCACCTCAGTGAAGGGCAGGTCCAAGG
CCTTCAACACTTGTGCTTCTCATGTGACAGCTGTTTCCTTGTTCTACACCTCTAGTGTCT
TTGTCTATTTGAGTTCCAGCTCTGGTGGCTCCTCCAGCTTTGACAGATTTGCATCTGTCT
TCTACACGGTGGTGATTCCTATGTTGAATCCTTTGGTTTACAGTCTGAGGAACAAGGAAA
TTAGAGATGCTGTAAAGAGGCTAAAGAAGAAGCTGGGATGCTGCTAA


Conceptual translation

IKGKNITEITQFILLGFSDFHQITALLFVIFLTLYITALTWNLSLIVLIRMDSYLHTPMY
FFLSNLSFIDLCYITSTVPKMLSNFFQEMQTISFVGCIVQYFIFSTMGLTESCLMTAMAY
DRYAAICNPLLYSSIMSPSLCARMLLGSYTAGLVGSVSQVCALLQLHFCGPNVIRHFFCD
MPQLLNLSCIDTLFAQVLLAVLTTLFGFSNALAIMISYGHIILSIMKITSVKGRSKAFNT
CASHVTAVSLFYTSSVFVYLSSSSGGSSSFDRFASVFYTVVIPMLNPLVYSLRNKEIRDA
VKRLKKKLGCC