Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5an10 Olfactory Receptor

Gene Symbol Or5an10
Organism Mouse
Family 5
Subfamily an
Pseudo No
Location chr19:12,298,200-12,299,100 (-)
Aliases Olfr1436

Sequence information


Nucleotide sequence

MEAMIKGKNITEITEFILLGFSDFPQITALLFVIFLTLYITALTWNLSLVVLIRMDSYLH
TPMYFFLSNLSFIDICYISSTVPKMLFNFFQKRQTISFVGCIVQYFMFSTMGLSESCLMT
AMAYDRYAAICNPLLYSSVMSPTLCAQMVMGSYTAGFIGSVSQVFAMLQLHFCGPNVIRH
FFCDIPQLLNLSCTDTFFAHVELLILTMLFCISNALVIIISYGYIVLSILKITSAKGRSK
AFNTCASHLTAVSLFYTSTAFVYFSSSSGGSSSFDRFVSVFYTVLITMLNPLVYSLRNKE
IKDAGKRLQKKLGCC


Conceptual translation

MEAMIKGKNITEITEFILLGFSDFPQITALLFVIFLTLYITALTWNLSLVVLIRMDSYLH
TPMYFFLSNLSFIDICYISSTVPKMLFNFFQKRQTISFVGCIVQYFMFSTMGLSESCLMT
AMAYDRYAAICNPLLYSSVMSPTLCAQMVMGSYTAGFIGSVSQVFAMLQLHFCGPNVIRH
FFCDIPQLLNLSCTDTFFAHVELLILTMLFCISNALVIIISYGYIVLSILKITSAKGRSK
AFNTCASHLTAVSLFYTSTAFVYFSSSSGGSSSFDRFVSVFYTVLITMLNPLVYSLRNKE
IKDAGKRLQKKLGCC