Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5an11 Olfactory Receptor

Gene Symbol Or5an11
Organism Mouse
Family 5
Subfamily an
Pseudo No
Location chr19:12268232-12269167 (+)
Aliases Olfr235, MOR214-3, Olfr235-ps1, MOR214-3, Olfr235-ps1

Sequence information


Nucleotide sequence

ATGATTGGGGAAAGAAATATTACCAAGATCACCCAGTTCATCCTCCTGGGATTCTCAGAT
TTCCCCAGAATCACAGTACCTCTTTTTGTAATGTTTTTGATGATCTACACTTTGGCTGTA
ACCTGGAACTTTTCCCTTATTGCTTTAATAAGATTGGATTCCCACCTTCACACACCCATG
TATTTCTTCCTCAGTAATCTCTCCATTATAGACATCTGCTATATCACTTCCACAGCCCCC
AAGATGCTTTCCAACTTCTTCCAGGAAAACCAAACTATCAGCTTTGTGGGCTGCATAGTT
CAATACTTTATCCTTTCCACTATGGGGCTGACTGAATCTTGCCTCATGACAGCCATGGCC
TATGACAGGTATGCTGCCATTTGTAACCCTCTTCTGTACTCATCAGTCATGTCACCCACA
CTATGTGCTCAGATGGTGATGGGAAGCTACACAGCTGGACTCACAGGCTCTGTATCTCAG
ATATGTGCCTTGCTGCAGCTCTATTTCTGTGGCCCTAATGTCATTAGGCATTTCTTCTGT
GACATATCTCAGCTATTAAATCTATCCTGTAGTGATGCTTTCTTTGTACAGGTCCTTCTT
GCTATATTAACCATGTGTTTTGGAATAGCAAATGCCTTAGCCACCATGCTGTCCTATGGT
TTCATCGTCCTGTCCATCTTAAAGATCACTTCAGCTAAAGGCAGGTCCAAGGCCTTCAAC
ACCTGTGCTTCTCACCTGACAGCTGTTTCTCTCTTCTATAGTACTGCCATCTTTGTCTAT
TTGCGATCCAGCTCTGGTGGCTCCTCTAGTTTTGACAGATTTGCATCTGTCTTCTACACT
GTGGTGATTCCTATGTTGAACCCTTTGATTTATAGTCTGAGAAACAAGGAAATCAAAGAT
GCCATGAAGCGGTTGCAGAAAAAGAAAATTTGCAGC


Conceptual translation

MIGERNITKITQFILLGFSDFPRITVPLFVMFLMIYTLAVTWNFSLIALIRLDSHLHTPM
YFFLSNLSIIDICYITSTAPKMLSNFFQENQTISFVGCIVQYFILSTMGLTESCLMTAMA
YDRYAAICNPLLYSSVMSPTLCAQMVMGSYTAGLTGSVSQICALLQLYFCGPNVIRHFFC
DISQLLNLSCSDAFFVQVLLAILTMCFGIANALATMLSYGFIVLSILKITSAKGRSKAFN
TCASHLTAVSLFYSTAIFVYLRSSSGGSSSFDRFASVFYTVVIPMLNPLIYSLRNKEIKD
AMKRLQKKKICS