Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5an12-ps Olfactory Receptor

Gene Symbol Or5an12-ps
Organism Rat
Family 5
Subfamily an
Pseudo Yes
Location chr1:229,399,000-229,400,000 (+)
Aliases Olr335-ps

Sequence information


Conceptual translation

GKEGTTVKFILLGVSEFPKLTTASSQYS*IYLMMLSWNVSLFILIKLDTHLHI\SNLAI
LDI/YVSIIT\RCFRKHKSIFFVGCTL**YFSSLAVAEHCLLTIMAYDW*AAICNPLI
STAIVSC/ICVHMMAESFISGFFGSFIQL*ALLQPDFCGPNINHFFYDLHELLTLCYSD
TFSF*VMDP/LTVMFELTSVLVNMVSYGYIIATILKITSTEGRSKASNTCASRLTTV/
/LFGSGIFVYMYSWEISK/KLALALYAIMIPMSNPLIYSLRNKEIKDSLNRLNKRLFV