Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5an1b Olfactory Receptor

Gene Symbol Or5an1b
Organism Mouse
Family 5
Subfamily an
Pseudo No
Location chr19:12321890-12322825 (-)
Aliases Olfr1437, MOR214-6, MOR214-6

Sequence information


Nucleotide sequence

ATGATTAAGGAAAGAAACTTTACTGAGATCACCGAATTCATCCTCCTAGGATTCTCTGAT
TTCCCCCAAATCACAGCACTGCTTTTTGTTATGTTCCTCATCCTGTATATTACAACCCTG
ACCTGGAACCTGTCCCTTGTTGTTTTAATAAGGATGGACTCCTATCTCCATACACCTATG
TACTTCTTCCTTAGTAATCTGTCCTTTATAGACATCTGCTATATCTCTTCTACAGTCCCA
AAGATGCTTTCCAACCTCTTCCAGGAAAAGCAAACTATCAGCTTTGTGGGCTGCATAGTT
CAATACTTTATGTTTGCCACAATGGGACTGAGTGAATCTTGCCTCATGACAGCCATGGCC
TATGACAGGTATGCTGCCATTTGTAACCCTCTTCTGTACTCATCAGTCATGTCACCCACA
CTTTGCGCTCAGATGGTGATGGGAAGCTACACAGCAGGAATCATGGGTTCTCTATCTCAG
GTGTGTGCCTTGCTGCAGCTCCACTTCTGTGGACCTAACGTCATCAGACATTTCTTCTGT
GACATGCCCCAGCTGTTAAATCTATCCTGCACTGACACTTTTTTTGCACAGGTAGTGCTT
CTCATATTAACAATGTTGTTTTGTATTTCAAATGCTTTAGTCATCATAATATCCTATGGC
TATATTGTCTTGTCCATTCTGAAGATCACTTCAGCTAAGGGTAGGTCCAAGGCATTCAAT
ACTTGTGCTTCTCACCTGACAGCTGTTTCCCTATTCTACACCTCCAGTGCTTTTGTATAT
TTGAGTTCCAGCTCTGGTGGCTCCTCCAGCTTTGATAGATTTGTGTCTGTCTTCTACACT
GTGTTGATTCCTATGTTGAACCCTTTGGTTTATAGTCTGAGGAACAAGGAAATCAAAGAT
GCTGGAAAGAGGTTACAGAAGAAGCTGGGATGCTGC


Conceptual translation

MIKERNFTEITEFILLGFSDFPQITALLFVMFLILYITTLTWNLSLVVLIRMDSYLHTPM
YFFLSNLSFIDICYISSTVPKMLSNLFQEKQTISFVGCIVQYFMFATMGLSESCLMTAMA
YDRYAAICNPLLYSSVMSPTLCAQMVMGSYTAGIMGSLSQVCALLQLHFCGPNVIRHFFC
DMPQLLNLSCTDTFFAQVVLLILTMLFCISNALVIIISYGYIVLSILKITSAKGRSKAFN
TCASHLTAVSLFYTSSAFVYLSSSSGGSSSFDRFVSVFYTVLIPMLNPLVYSLRNKEIKD
AGKRLQKKLGCC