Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5an6 Olfactory Receptor

Gene Symbol Or5an6
Organism Rat
Family 5
Subfamily an
Pseudo No
Location chr1:229416489-229417448 (+)
Aliases Olr336, Olr336

Sequence information


Nucleotide sequence

ATGCCAGGAGGGAGGAATAACACCATCATCACCAAGTTCATCCTTGTGGGATTCTCAGAT
TTTCCCAAGATCAAGTTGGTTCTCTTTGTTGTCTTCCTGGGAAGTTATCTCTCCACAGTA
GTATGGAACTTGGGTCTCGTCATCTTGATTAGGATTGACCCTTACCTACACACACCTATG
TACTTCTTCCTCAGCAATTTGTCGTTTTTAGATTTCTGTTACATTTCATCTACAACCCCT
AAAATGCTCTCAGGATTCTTCCAGAAGCTTAAATCTATCTCCTTTGTGGGGTGCACCATG
CAGTATTTCTTCTTCTCAAGCCTGGGTCTGGCCGAATGCTGCCTTCTGGCAGCCATGGCT
TATGACCGGTATGCTGCTATTTGTAACCCTCTTCTCTACACAGCTATTATGTCCCCATCG
CTCTGTGTGCACATGGTGGTTGGAGCCTACACCATTGGTCTCTTTGGTTCATTAATTCAA
CTGTGTGCTATACTTCAGCTTCATTTCTGTGGGCCAAACATTATAAACCATTTCTTTTGT
GACCTGCCTCAGCTATTAGTCCTCTCCTGCTCTGAAACCTTTCCCTTGCAAGTCCTGAAA
TTTGTAATAGCAGTGATTTTTGGGGTGGCATCTGTATTGGTTATTCTGGTATCCTATGGT
TATATCATCAGCACAATCCTGAATATTAGTTCAGTAGAAGGTAGGTCCAAGGCATTCAAT
ACCTGTGCCTCTCATCTGACAGCAGTCACCCTCTTTTTTGGATCAGGACTGTTTGTCTAT
ATGCTCCCCAACTCTGACAGTTCTCAGGGTTATGACAAGATGGCTTCTGTGTTCTATACA
GTGGTGATTCCCATGTTGAATCCTCTGATTTACAGTCTCAGGAACAAGGAAATCAAAGAT
GCTCTTCAGAGATGCAAAAAGAAGTGCTTTTCTCATTGCCACTGCCAGTTAAAGATCTGT


Conceptual translation

MPGGRNNTIITKFILVGFSDFPKIKLVLFVVFLGSYLSTVVWNLGLVILIRIDPYLHTPM
YFFLSNLSFLDFCYISSTTPKMLSGFFQKLKSISFVGCTMQYFFFSSLGLAECCLLAAMA
YDRYAAICNPLLYTAIMSPSLCVHMVVGAYTIGLFGSLIQLCAILQLHFCGPNIINHFFC
DLPQLLVLSCSETFPLQVLKFVIAVIFGVASVLVILVSYGYIISTILNISSVEGRSKAFN
TCASHLTAVTLFFGSGLFVYMLPNSDSSQGYDKMASVFYTVVIPMLNPLIYSLRNKEIKD
ALQRCKKKCFSHCHCQLKIC