Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5an8-ps Olfactory Receptor

Gene Symbol Or5an8-ps
Organism Mouse
Family 5
Subfamily an
Pseudo Yes
Location chr19:12177610-12178523 (-)
Aliases Olfr1430-ps1, MOR214-8P

Sequence information


Nucleotide sequence

ATGAATGCCAGGGGAAACAGTACTGAGATCACCCAGTTCATCCTCCTGGGAGTCACAAAT
TTACCCAGAATAATAATACTGCTCTTTGTCACATTTCTGCTCATCTACATTACAACTCTC
ACCTGGAATCTGTCCCTCATTGTGTTAATAAGAATGGATTCACACCTCCACACTCCCATG
TATTTCTTTCTCTATAACCTGTCCATCATAGGACTTTGCTATGTCACCTGCACAGTCCCA
AAAAAAATGCTCTCAAACTTTTTCCAGGAAAAGCAAACTATCAGCTTTGTGGGCTGCATT
GTTCAGAATTCATCTTTTTCACCATGGGGCTGAGTGAGTCTTGTCTCATGGCAGCCATGG
CCTATGACCGGTATGCTGCCATTTGTAACCCTCTTCTGTATGCATCGATCATGTCACCCA
CTTTTTGTGTACTGAAGGTGCTGGAATCCTATCTCTCTGGGATCACTGCTTCTTTACTTC
AGTTGTTTGCTTTGCTTCTGTGGAACTAATGTCATCAAGCACTTCTTTTGTGGCATGCCA
CAGTTGTTAGTTCTGTCCTGCATAGACAATTCCTGACTGCCATATTAACAATGATCTTTG
GATTTGTAAACATGCTAGTTATCATGATATCTTATGGCTATATTGTCATGTCCATCCTGA
AGATCACGTCAGCTAAAGGCAGATCCAAAGCATTCAACACCTGTGCTCCACACTTGACAC
CTGTTTCCCTATTCCTCACCTCCAGTATCTTTGTCTATTTGAGTTCAAGTTCTGGTGGCT
CCTCCAGTTTTGACAGATTTGTGTCTGTTGTCTACACTGTGGTGATTCCCGTGTTGATCC
CTTTGATATACAGTCTGAAGAACAGAGAAATCAAAGATGCTATGAAGAGGTTAAAGAAAA
AGACAATCTGCAGC


Conceptual translation

MNARGNSTEITQFILLGVTNLPRIIILLFVTFLLIYITTLTWNLSLIVLIRMDSHLHTPM
YFFLYNLSIIGLCYVTCTVPKKMLSNFFQEKQTISFVGCIVQNSSF/TMGLSESCLMAA
MAYDRYAAICNPLLYASIMSPTFCVLKVLESYLSGITASLLQ\LLCFCGTNVIKHFFCG
MPQLLVLSCIDNS/TAILTMIFGFVNMLVIMISYGYIVMSILKITSAKGRSKAFNTCAP
HLTPVSLFLTSSIFVYLSSSSGGSSSFDRFVSVVYTVVIPVLIPLIYSLKNREIKDAMKR
LKKKTICS