Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5an9 Olfactory Receptor

Gene Symbol Or5an9
Organism Mouse
Family 5
Subfamily an
Pseudo No
Location chr19:12209568-12210503 (+)
Aliases Olfr1431, MOR214-5

Sequence information


Nucleotide sequence

ATGATTGGGGAAAGAAATATTACCACAATAACCCAGTTCATCCTCCTGGGATTTTCAGAT
TTCCCTAGAATCACAGTTCTGCTTTTTGTCATATTTTTGATGATCTACATTATGACTATG
ACCTGGAACTTGTCCCTTATTGCTTTAATAAGAATGGATTCCCACCTTCACACACCCATG
TATTTCTTCCTCAGTAATCTCTCCTTTATAGACCTCTGCTTTGTTACTTCCACAGCCCCC
AAGATGCTTTCCAACTTCTTCCAGGAAAACCAAACTATCAGCTTTGTGGGCTGCATAGTT
CAATACTTTATCCTTTCCACTATGGGGCTGACTGAATGTTGCCTCATGACAGCCATGGCC
TATGACAGGTATGCTGCCATTTGTAACCCTCTTCTGTACTCATCAGTCATGTCACCCACA
CTATGTGCTCAGATGGTGATGGGAAGCTACACAGCAGGACTCACAGGCTCTGTATCTCAG
ATATGTGCCTTGCTGCAGCTCTATTTCTGTGGCCCTAATGTCATTAGGCATTTCTTCTGT
GACATATCTCAGCTATTAAATCTATCCTGTAGTGATGCTTTCTTTGTACAGGTCCTTCTT
GCTATATTAACCATGTGTTTTGGAATAGCAAATGCCTTAGCCACCATGCTGTCCTATGGT
TTCATCGTCCTGTCCATCTTAAAGATCACTTCAGCTAAAGGCAGGTCCAAGGCCTTCAAC
ACCTGTGCTTCTCACCTGACAGCTGTTTCTCTCTTCTATAGTACTGGCATCTTTGTCTAT
TTGCGATCCAGCTCTGGTAGCTCCTCCAGTTTTGACAGATTCACATCTGTCTTCTACACT
GTGGTGATTCCCATGTTGAACCCTTTGATATATAGTCTGAGAAACAAGGAAATCAAAGAT
GCCATGAAGCGGTTGCAGAAAAAGAAAATCTGCAAC


Conceptual translation

MIGERNITTITQFILLGFSDFPRITVLLFVIFLMIYIMTMTWNLSLIALIRMDSHLHTPM
YFFLSNLSFIDLCFVTSTAPKMLSNFFQENQTISFVGCIVQYFILSTMGLTECCLMTAMA
YDRYAAICNPLLYSSVMSPTLCAQMVMGSYTAGLTGSVSQICALLQLYFCGPNVIRHFFC
DISQLLNLSCSDAFFVQVLLAILTMCFGIANALATMLSYGFIVLSILKITSAKGRSKAFN
TCASHLTAVSLFYSTGIFVYLRSSSGSSSSFDRFTSVFYTVVIPMLNPLIYSLRNKEIKD
AMKRLQKKKICN