Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5an9 Olfactory Receptor

Gene Symbol Or5an9
Organism Rat
Family 5
Subfamily an
Pseudo No
Location chrUn_KL568468v1:108681-109631 (+)
Aliases Olr329, Olr329

Sequence information


Nucleotide sequence

ATGAGCACTGAAATGGTGATTGGGGGAGGAAATATTACCAAGATCACCCAGTTCATCCTC
CTAGGATTCTCAGATTTCCCCAGAATCACAGTACTGCTTTTTGTCATATTTTTGATGATC
TACATTATGACTATGACCTGGAACTTGTCTCTTATTGCTTTAATAAGAATGGATTCCCAC
CTTCACACACCCATGTATTTCTTCCTTAGTAACCTATCCTTTATAGACCTTTGCTTTGTT
ACTTCCACAGCCCCCAAAATGCTTTCCAACTTCTTCCAGGAAAAGCAAACTATCAGCTTT
GTGGACTGTATAGTTCAGTACTTTATCCTTTCCACTATGGGGTTGACTGAATGTTGCCTC
ATGACAGCCATGGCCTATGACAGGTATGCTGCCATTTGTAACCCTCTTCTCTACTCATCA
GTCATGTCACCCACACTATGTGCTCAGATGGTGATGGGAAGCTACACAGCAGGACTCACA
GGTTCTTTATCTCAGGTGTGTGCCTTGCTGCAGCTCCATTTCTGTGGACCTAATGTCATC
CGGCATTTTTTCTGTGACATATCCCAGTTGTTAAATCTATCCTGTAGTGATGCGTTTTTT
ATACAAGTCCTTCTTGCTATATTAACAATGTGTTTTGGAATAGCAAATGCCTTTGCTACC
ATGCTGTCTTATGGTTTTATCGTCCTGTCCATCTTAAAGATCACTTCAGCTAAAGGCAGG
TCCAAGGCCTTCAACACCTGTGCTTCTCACCTGACAGCTGTTTCTCTCTTCTATAGTACT
GGCATCTTTGTCTATTTGCGATCCAGCTCTGGCGGTTCCTCCAGCTTTGACAGATTTACA
TCTGTCTTTTACACTGTGGTGATTCCTATGTTGAACCCTTTAATATGTAGTCTGAGGAAC
AGAGAAATCAAAGATGCCATGAAGAGGTTGCAGAAAAAGAAAATCTGCACC


Conceptual translation

MSTEMVIGGGNITKITQFILLGFSDFPRITVLLFVIFLMIYIMTMTWNLSLIALIRMDSH
LHTPMYFFLSNLSFIDLCFVTSTAPKMLSNFFQEKQTISFVDCIVQYFILSTMGLTECCL
MTAMAYDRYAAICNPLLYSSVMSPTLCAQMVMGSYTAGLTGSLSQVCALLQLHFCGPNVI
RHFFCDISQLLNLSCSDAFFIQVLLAILTMCFGIANAFATMLSYGFIVLSILKITSAKGR
SKAFNTCASHLTAVSLFYSTGIFVYLRSSSGGSSSFDRFTSVFYTVVIPMLNPLICSLRN
REIKDAMKRLQKKKICT