Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5ap2 Olfactory Receptor

Gene Symbol Or5ap2
Organism Mouse
Family 5
Subfamily ap
Pseudo No
Location chr2:85849454-85850404 (+)
Aliases Olfr1020, RP23-384L16.7, MOR201-2, RP23-384L16.7, MOR201-2

Sequence information


Nucleotide sequence

ATGGTCAGGAGTGGAAAAGGAATCCAAAATAAGAATGCCACAGAAGTGACAGAATTTATC
CTTTTGGGTCTCTCAGACAATCCAGACTTGCAAGGTGTCCTCTTTGCATTATTCCTGATC
ATCTACACGATGACACTGGTGGGTAATTTGGGCATGATGGCCCTGATTAAGATTGACCGC
AGTCTGCACACACCTATGTACTTCTTTCTCAGCAGCCTTTCTTTTGTTGATGCCTCTTAT
TCTTCTTCTGTCACCCCCAAGATGCTAGTGAACCTCATGGCTGAGGATAAGAGCATTTCT
TTCAATGGATGTGCTACCCAGTTCTTTTTCTTCGGTTCCTTCTTGGGAACTGAATGCTTC
CTGCTAGCCATGATGGCCTATGACCGCTATGCAGCCATCTGGAATCCCCTGCTATACCCA
GTTCTCATGTCTGGGAGAATTTGTTTCATGTTGGTGTCTACTTCATTCTTAGCAGGCTTT
GGCAATGCAGCCATCCACACAGGGATGACTTTCAGACTGTCCTTTTGTGGCTCTAATAAG
ATCAATCATTTCTATTGTGACACCCCACCCCTGCTCAAACTCTCTTGCTCTGACACTCAC
ATTAATGGCATTGTGATCATGGCCTTCTCCAGTTTCAATGTCATCAGTTGTGTTCTGATT
GTTTTGATATCTTACTTGTGCATCCTCATTGCCATACTGAAGATGCCTTCAGCAGAGGGA
AGACACAAAGCCTTCTCCACCTGTGCCTCCCACCTCATGGCTGTTACCATCTTTTTTGGA
ACAATTCTTTTCATGTACTTGCGCCCTACCTCTAGCTACTCTATGGAACAGGACAAAGTT
GTCTCTGTGTTTTATACAGTAGTCATTCCAATGCTTAATCCTCTCATCTATAGTTTAAAA
AATAAAGATGTTAAGAAAGCAGTGAAGAAAATCTTACATAATTATGTGGTT


Conceptual translation

MVRSGKGIQNKNATEVTEFILLGLSDNPDLQGVLFALFLIIYTMTLVGNLGMMALIKIDR
SLHTPMYFFLSSLSFVDASYSSSVTPKMLVNLMAEDKSISFNGCATQFFFFGSFLGTECF
LLAMMAYDRYAAIWNPLLYPVLMSGRICFMLVSTSFLAGFGNAAIHTGMTFRLSFCGSNK
INHFYCDTPPLLKLSCSDTHINGIVIMAFSSFNVISCVLIVLISYLCILIAILKMPSAEG
RHKAFSTCASHLMAVTIFFGTILFMYLRPTSSYSMEQDKVVSVFYTVVIPMLNPLIYSLK
NKDVKKAVKKILHNYVV