Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5ap2 Olfactory Receptor

Gene Symbol Or5ap2
Organism Rat
Family 5
Subfamily ap
Pseudo No
Location chr3:73235594-73236544 (+)
Aliases Olr463, Olr463

Sequence information


Nucleotide sequence

ATGGTGAGAACTCTAAAAGGAGACCAAGATAAAAATGACACAGAAGTGACAGAATTTATC
CTTTTGGGCCTCTCAGACAATCCAGACCTACAATGTATCCTCTTTGCATTGTTTCTGGTC
ATCTACATGGTGACACTGGTGGGTAATTTGGGCATGATGGCCCTGATTAAGATTGACCGC
AGTCTGCACACACCTATGTATTTCTTTCTCAGCAGTCTTTCTTTTGTTGATGTCTCTTAT
TCTTCTTCTGTTACCCCTAAGATGCTAGTAAACCTCATGGCTGAGGATAAGGGCATTTCT
TTCAATGGCTGTGCTACCCAGTTCTTCTTCTTTGGCTCTTTCTTGGGAACTGAATGCTTC
CTGTTAGCCATGATGGCCTATGACCGCTATGCAGCCATCTGGAATCCCCTCCTATACCCA
GTTCTCGTGTCTGGAAAAATTTGTTTCATGTTGGTGTCTACTTCATTTCTAGCAGGCTTT
GGCAATGCAGCCATCCACACAGGAATGACTTTCCGACTGTCCTTTTGTGGCTCTAATAAG
ATCAATCATTTCTATTGTGACACCCCACCCTTGCTCAAACTCTCTTGCTCTGACACTCGC
ATTAATGGCATTGTGATCATGGCCTTCTCTAGTTTCAATGTCATCAGCTGTGTTCTGATT
GTTCTCATTTCATATCTGTGCATCCTCATTGCCATATTGAAGATGCCTTCTGCAGAGGGA
AGACACAAAGCCTTCTCCACCTGTGCCTCCCACCTCATGGCTGTCGCCATCTTCTTTGGA
ACAATTCTTTTCATGTACTTGCGTCCTTCCTCTAGCTACTCTATGCAGCAAGACAAAGTT
GTCTCTGTGTTTTATACAGTAGTGATTCCGATGCTTAATCCTCTCATCTATAGTTTAAAA
AATAAAGATGTTAAGAAAGCAGTGAAGAAAATCTTACAGAATTGTGTGCTT


Conceptual translation

MVRTLKGDQDKNDTEVTEFILLGLSDNPDLQCILFALFLVIYMVTLVGNLGMMALIKIDR
SLHTPMYFFLSSLSFVDVSYSSSVTPKMLVNLMAEDKGISFNGCATQFFFFGSFLGTECF
LLAMMAYDRYAAIWNPLLYPVLVSGKICFMLVSTSFLAGFGNAAIHTGMTFRLSFCGSNK
INHFYCDTPPLLKLSCSDTRINGIVIMAFSSFNVISCVLIVLISYLCILIAILKMPSAEG
RHKAFSTCASHLMAVAIFFGTILFMYLRPSSSYSMQQDKVVSVFYTVVIPMLNPLIYSLK
NKDVKKAVKKILQNCVL