Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5ap2b-ps Olfactory Receptor

Gene Symbol Or5ap2b-ps
Organism Mouse
Family 5
Subfamily ap
Pseudo Yes
Location chr2:85,863,400-85,864,400 (+)
Aliases Olfr1021-ps1

Sequence information


Nucleotide sequence

MVRTMKGIQDKNATEVTEFILLGLSENPDLQGVLFALFLIIYTMTLVGNLGMMALIKIDR
SLHTPMYFFLSSLS\FDASSSSTVTPKMLLNLVAEDKSISFNGCATQFFFFGSFLGTECF
LLAMMAYDRYAAIWNPLLYPVLMSGSICFMLVSTSFLAGFGNAAIHTGMTFRLSFCGSNK
INHFYCDTPPLLKLSCSDIHINGIVIMAFSSFTVLICVLIVLISYLCILIAILKMPSAEG
RHKAFSTCASHLMAVTIFFGSILFMYLRPTTSYSMEQDKIVSVFYTVVIPMLNPLIYSLK
NRDVKEAVKKILQKHIL


Conceptual translation

MVRTMKGIQDKNATEVTEFILLGLSENPDLQGVLFALFLIIYTMTLVGNLGMMALIKIDR
SLHTPMYFFLSSLS\DASSSSTVTPKMLLNLVAEDKSISFNGCATQFFFFGSFLGTECF
LLAMMAYDRYAAIWNPLLYPVLMSGSICFMLVSTSFLAGFGNAAIHTGMTFRLSFCGSNK
INHFYCDTPPLLKLSCSDIHINGIVIMAFSSFTVLICVLIVLISYLCILIAILKMPSAEG
RHKAFSTCASHLMAVTIFFGSILFMYLRPTTSYSMEQDKIVSVFYTVVIPMLNPLIYSLK
NRDVKEAVKKILQKHIL