Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5ap2b Olfactory Receptor

Gene Symbol Or5ap2b
Organism Rat
Family 5
Subfamily ap
Pseudo No
Location chr3:73,249,700-73,250,700 (+)
Aliases Olr464

Sequence information


Nucleotide sequence

ATGACACAATCATCTAGCCAAATGGAATGCTGTAACTTCTTTTATTTTGTAGCACAGATG
GTCAGAATTGTAAAAGGAATCCAAGATAAAAATGACACAGATGTGACAGAATTTATCCTT
CTGGGCCTCTCAGACAATCCAGACCTACAACATTTCCTCTTTATATTGTTTCTGATCATC
TACATGGTGACACTGGTGGGTAATTTAGGGATGATGGCCCTGATTAAGATTGACCGCTGT
CTGCACACACCTATGTACTTTTTTCTTAGCAGCCTTTCTTTTGTTGATGCCTCTTCCTCA
TCTACAGTCACCCCTAAAATGCTGCTGAACCTCATGGCTGAAGATAAGAGCATTTCTTTC
AATGGATGTGCTACCCAGTTCTTCTTCTTTGGCTCTTTCTTGGGAACTGAATGCTTCCTG
TTAGCCATGATGGCCTATGACCGCTATGCGGCCATCTGGAGTCCCCTCCTATACCCAGTT
CTCATGTCTGGGAGAATTTGTTTCATGTTCGTGTCTACTTCATTTCTAGCAGGGTTTGGC
AATGCAGCCATCCACACAGGAATGACTTTCCGACTGTCCTTTTGTGCCTCTAATAAGATC
AATCATTTCTATTGTGACACACCACCCCTACTCAAACTCTCTTGCTCTGACATCCATACG
AATGGCATTGTGATCATGATTTTTTCCAGTTTTACTGTTCTCATCTGTGTTCTCATTGTT
CTCATTTCTTACCTGTGCATCCTCATTGCCATATTGAAAATGTCTTCTGCAGAGGGAAGA
CACAAAGCCTTCTCCACCTGCTCCTCCCATCTGATGGCTGTTACTATCTTCTTTGGTTCA
ATTCTCTTTATGTACTTGCGACCTACTACTAGCTACTCTATGGAACAAGACAAGGTCGTC
TCTGTGTTTTATACAGTAGTGATCCCCATGCTTAATCCTCTCATCTACAGTTTAAAAAAT
AAAGATGTGAAAGAGGCAGTAAAAAAAATCATACAGAAACACATTCTA


Conceptual translation

MTQSSSQMECCNFFYFVAQMVRIVKGIQDKNDTDVTEFILLGLSDNPDLQHFLFILFLII
YMVTLVGNLGMMALIKIDRCLHTPMYFFLSSLSFVDASSSSTVTPKMLLNLMAEDKSISF
NGCATQFFFFGSFLGTECFLLAMMAYDRYAAIWSPLLYPVLMSGRICFMFVSTSFLAGFG
NAAIHTGMTFRLSFCASNKINHFYCDTPPLLKLSCSDIHTNGIVIMIFSSFTVLICVLIV
LISYLCILIAILKMSSAEGRHKAFSTCSSHLMAVTIFFGSILFMYLRPTTSYSMEQDKVV
SVFYTVVIPMLNPLIYSLKNKDVKEAVKKIIQKHIL