Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5aq1 Olfactory Receptor

Gene Symbol Or5aq1
Organism Mouse
Family 5
Subfamily aq
Pseudo No
Location chr2:87135384-87136319 (-)
Aliases Olfr1110, RP23-116P4.4, MOR172-4, RP23-116P4.4, MOR172-4

Sequence information


Nucleotide sequence

ATGGCAATTTGGAATCATACAGGTGTGAGTGAATTCATTCTGGTAGGCCTGACTGAAAAT
CCTAATTGGCAGGTTCCTCTCTTCTTGCTTTTCAGTGTAGTGTATTTCATCATTCTTGTA
GGTAACTGGGGAATGATTATCTTGATCTGGTTGAATGCCCAACTTCATACACCAATGTAC
TTTTTCCTTAGTAACCTTTCTTTCTGTGATATCTGCTACTCTACTATCATTGCTCCAAAG
ATGCTGCTCAATTTCTTGTCAGAACACAAGTCTAGTACATTCTTTGCCTGTATTCTGCAG
AGTTTCTTTTTTGCAGTTTATGTAACGACAGAAGTAATCCTCCTGTCTATGATGGCCTAT
GATCGCTATGTGGCAATTGCAAATCCCTTAATGTATACGGTTATCATGACACACAACATC
TGCACTCAAATGGTTCTTGCAAGTTACTTGGGGGGCCTCATAAATTCCATGATTCATACA
ATAGGTTTACTCAAACTAGACTTCTGTGGTCCAAATATTGTGAATCACTTCTTCTGTGAT
GTTCCTCCTCTTTTGAAGCTTGCATGCTCTGATGCACACATCAATGAGATGCTGCTTTTG
GTCTTCTCTGGAATGATTGCTATTTTCACTTTCATCATCATCATGGTGTCCTATATCCAC
ATTATCATTGCCATCCTGAGAATCCGCTCAGCTGAGGGGAGGCGCAAAGCTTTCTCCACT
TGTGCCTCACATTTGACAGCTGTGACATTATTTTATGGGTCTTTGACTTTTAATTATATC
CAACCAAGCTCGCAGTACTCCATGGAACAGGAAAAGCTCTCTGCTATGTTTTACACCTTG
GTCATCCCTATGCTGAACCCTCTGATTTACAGCCTGAGGAACAAGGATGTGAAGGAGGCA
GCAAAAAGGTTGATTTGTAGGGAGAGCAGTACCTCA


Conceptual translation

MAIWNHTGVSEFILVGLTENPNWQVPLFLLFSVVYFIILVGNWGMIILIWLNAQLHTPMY
FFLSNLSFCDICYSTIIAPKMLLNFLSEHKSSTFFACILQSFFFAVYVTTEVILLSMMAY
DRYVAIANPLMYTVIMTHNICTQMVLASYLGGLINSMIHTIGLLKLDFCGPNIVNHFFCD
VPPLLKLACSDAHINEMLLLVFSGMIAIFTFIIIMVSYIHIIIAILRIRSAEGRRKAFST
CASHLTAVTLFYGSLTFNYIQPSSQYSMEQEKLSAMFYTLVIPMLNPLIYSLRNKDVKEA
AKRLICRESSTS