Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5aq1 Olfactory Receptor

Gene Symbol Or5aq1
Organism Rat
Family 5
Subfamily aq
Pseudo No
Location chr3:74,669,500-74,670,400 (-)
Aliases Olr540

Sequence information


Nucleotide sequence

ATGAGACTCTGGAATCATACAGGTGTGAAAGAATTCATACTAGTCGGATTGACAGAAAAC
CTTAATTGGCAAGTCGGACTCCTTTTCCTTTTCAGTATAATTTATTTTATCATTCTTGTG
GGTAACTGGGGGATGATTCTCTTGATCTGGTTGAATGCCCATCTTCATACTCCAATGTAC
TTCTTTCTTAGTAACCTCTCTTTTTGTGATATCTGCTATTCTACTGTCATTGCTCCTAAA
ATGCTCATTAATTTCCTGTCAAAATACAAGTCTAGCACATTCTTTGGTTGTGTTATTCAG
AGTTTCTTTTTTGCAGTGTATATAACTACAGAAGGTATACTCTTGTCTATGATGGCTTAT
GATCGTTATGTGGCAATTGCAAACCCCTTAATGTATACAGTTATTATGACACACAGCATC
TGCAGTCAGATGGTTCTTGTATGTTACTTGGGTGGCCTTATTAATTCCCTGACTCACACA
ATAGGTTTACTTAGACTGGACTTCTGTGGTCCCAACATTGTAGACCATTTCTTCTGTGAC
ATCCCTCCTCTTTTGAAGCTTTCATGTTCTGATGCACACATCAATGAGATGCTGCTTTTG
GTCTTCTCTGGAGTGATTGCTATTTTCACTTTCATCATTGTCATGGTGTCCTATATTCAA
ATTATCATTGCCATCCTGAGAATCCGCTCAGCTGAGGGAAGGCGCAAAGCCTTCTCCACG
TGTGCCTCACATCTAACAGCTGTGACATTATTTTACGGTTCTGTGACATTTAGCTATATC
CAGCCAAGTTCTCAGTACTCCATGGAACAGGAAAAAGTCTCTGCTGTGTTTTACACCTTG
GTCATCCCCATGCTGAACCCTCTAATTTACAGCCTGAGGAACAAAGATGTGAAAGAGGCA
GCCAAGAGGTCAGTTTGTAGGGAGAGGAGTGGCCCT


Conceptual translation

MRLWNHTGVKEFILVGLTENLNWQVGLLFLFSIIYFIILVGNWGMILLIWLNAHLHTPMY
FFLSNLSFCDICYSTVIAPKMLINFLSKYKSSTFFGCVIQSFFFAVYITTEGILLSMMAY
DRYVAIANPLMYTVIMTHSICSQMVLVCYLGGLINSLTHTIGLLRLDFCGPNIVDHFFCD
IPPLLKLSCSDAHINEMLLLVFSGVIAIFTFIIVMVSYIQIIIAILRIRSAEGRRKAFST
CASHLTAVTLFYGSVTFSYIQPSSQYSMEQEKVSAVFYTLVIPMLNPLIYSLRNKDVKEA
AKRSVCRERSGP