Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5aq1b Olfactory Receptor

Gene Symbol Or5aq1b
Organism Mouse
Family 5
Subfamily aq
Pseudo No
Location chr2:87071197-87072132 (-)
Aliases Olfr1107, RP23-25M5.12, MOR172-2, RP23-25M5.12, MOR172-2

Sequence information


Nucleotide sequence

ATGAGAGTTTGGAATCATACAGGGGTCAAGGAATTCATGCTCCTTGGCTTAACAGAAAAC
CCTAATTGTCAGGTTCCTCTCTTTTTGCTTTTCAGTATAGTGTATCTCATCATACTTGTG
GGTAATTGGGGGATGATTATCTTGATCTGGCTGAATGCCCACCTTCATACACCAATGTAC
TTCTTCCTTAGTAACCTCTCTTTCTGTGACATCTGCTACTCTACTGTCATTGCTCCTAAA
ATGCTCATCGATTTTCTCTCAGAACACAAGTCTAGCACATTCTTTGGCTGTGTTCTTCAG
AGTTTCTTTTTTGCAGTATACATAACTACAGAAGGTATTCTTCTGTCTATGATGGCTTAT
GACCGTTATGTGGCAATCGCAAACCCCTTAATGTATACAGTTATTATGACCCACAGAATC
TGCAGTCAGATGGTTCTTGCATGTTACTTGGGTGGCCTCATTAATTCCCTGACTCACACA
ATAGGTTTACTCAGACTGGACTTTTGTGGTCCCAACATAGTGAATCACTTCTTCTGTGAC
ATCCCTCCTCTTTTGAAGCTTGCGTGCTCTGATGCACACAACAATGAGATGCTGCTTTTG
GTCTTCTCTGGAGTGATTGCTATTTTCACTTTCATCATTGTCATGGTGTCCTATATCCAT
ATTATCATTGCCATCCTGAGAATCCGCTCAGCTGAGGGAAGGCGCAAAGCCTTCTCCACT
TGTGCTTCACACCTGACAGCTGTGATATTATTTTATGGTTCTGTGACATTTAGTTATATC
CAGCCCAGCTCTCAGTACTCCATGGAACAGGAAAAAGTCTCTGCTGTGTTTTACACCTTA
GTCATTCCCATGCTAAATCCTCTAATTTACAGTCTGAGGAACAAAGATGTGAAAGAAGCA
GCCAAGAAGTTCATTGGTAGGGAGAGGAGAACCTCT


Conceptual translation

MRVWNHTGVKEFMLLGLTENPNCQVPLFLLFSIVYLIILVGNWGMIILIWLNAHLHTPMY
FFLSNLSFCDICYSTVIAPKMLIDFLSEHKSSTFFGCVLQSFFFAVYITTEGILLSMMAY
DRYVAIANPLMYTVIMTHRICSQMVLACYLGGLINSLTHTIGLLRLDFCGPNIVNHFFCD
IPPLLKLACSDAHNNEMLLLVFSGVIAIFTFIIVMVSYIHIIIAILRIRSAEGRRKAFST
CASHLTAVILFYGSVTFSYIQPSSQYSMEQEKVSAVFYTLVIPMLNPLIYSLRNKDVKEA
AKKFIGRERRTS