Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5aq1d Olfactory Receptor

Gene Symbol Or5aq1d
Organism Rat
Family 5
Subfamily aq
Pseudo No
Location chr3:75184082-75185017 (-)
Aliases Olr546, Olr546

Sequence information


Nucleotide sequence

ATGAGACTCTGGAATCATACAGGTGTGAAGGAATTCATACTAGTCGGATTAACAGAAAAC
CTTAATTGGCAAGTCGGGCTCTTTTTCCTTTTCAGCATAGTTTATTTTATCATTCTTGTC
GCTAACTGGGGGATGATTCTTTTGATCTGGTTGAATGCCCATCTTCATACTCCAATGTAC
TTCTTTCTTAGTAACCTCTCTTTTTGTGACATCTGCTATTCTACTGTCATTGCTCCTAAA
ATGCTCATTAATTTCCTGTCAGAATACAAGTCTAGCACATTCTTTGGTTGTGTTATTCAG
AGTTTCTTTTTTGCAGTGTATATAACTACAGAAGGTATACTCTTGTCTATGATGGCTTAT
GATCGTTATGTGGCAATTGCAAACCCCTTAATGTATACAGTTATTATGACACACAGCATC
TGCAGTCAGATGGTTCTTGTATGTTACTTGGGTGGCCTTATTAATTCCCTGACTCACACA
ATAGGTTTACTCAGACTGGACTTCTGTGGTCCCAACATTGTAGACCATTTCTTCTGTGAC
ATCCCTCCTCTTTTGAAGCTTTCATGTTCTGATGCACAGATCAATGAGATGCTGCTTTTG
TTCTTCTCTGGAGTGATTGGTATTTTCACTTTCATCATTGTCATGGTGTCCTATATTCAA
ATTATCATTGCCATCCTGAGAATCCGCTCAGCTGAGGGAAGGCGCAAAGCCTTCTCCACT
TGTGCCTCACACCTAACAACTGTGACATTACTTTATGGTTCTGCGACATTTAGCTATATC
CAGCCAAGTTCTCAATATTCCATGGAACAGGAAAAAGTCTCTGCTGTGTTTTACACCTTG
GTCATCCCCATGCTGAACCCTCTAATTTACAGCCTGAGGAACAAAGATGTGAAAGAAGCA
GTCAAGAGGTCAGTTTATAGGGAGAGGAGTGGCCCT


Conceptual translation

MRLWNHTGVKEFILVGLTENLNWQVGLFFLFSIVYFIILVANWGMILLIWLNAHLHTPMY
FFLSNLSFCDICYSTVIAPKMLINFLSEYKSSTFFGCVIQSFFFAVYITTEGILLSMMAY
DRYVAIANPLMYTVIMTHSICSQMVLVCYLGGLINSLTHTIGLLRLDFCGPNIVDHFFCD
IPPLLKLSCSDAQINEMLLLFFSGVIGIFTFIIVMVSYIQIIIAILRIRSAEGRRKAFST
CASHLTTVTLLYGSATFSYIQPSSQYSMEQEKVSAVFYTLVIPMLNPLIYSLRNKDVKEA
VKRSVYRERSGP