Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5aq6 Olfactory Receptor

Gene Symbol Or5aq6
Organism Mouse
Family 5
Subfamily aq
Pseudo No
Location chr2:87092460-87093395 (-)
Aliases Olfr1109, RP23-116P4.1, MOR172-5, RP23-116P4.1, MOR172-5

Sequence information


Nucleotide sequence

ATGGACCCAGGGAATCATACAGTTGTGAAGGAATTCATACTCCTTGGCTTAACAGAAAAT
CCCGATTGGCAGATTCCTCTCTTTTTGCTTTTCAGCATAATTTATTTAATCATTTTTGTG
GGTAACTGGGGAATGATCTTCTTGATCTGGTTGAATGCCCACCTTCATACCCCAATGTAC
TTCTTTCTTAGTAACCTCTCTTTCTGTGATATCTGCTACTCTACTGTCATTGCTCCTAAG
ATGCTCATCAATATCGTATCAGAACACAAATCTAGTAGACTCCTTTCTTGTGTTTTGCAG
AGTTTCTTTTTTATGGTGTATGCAACCACAGAAGTCATCCTCCTGTCTATGATGGCTTAT
GATCGCTATGTGGCAATTGTAAACCCCTTAATGTATACAGTTATTATGACATTCAGCATC
TGTATTAGCATGGTTCTTGCATGTTACTTGTGTGGCATCATTAATTCCCTGACTCACACA
ATAAGTCTACTGAGACTGGACTTCTGTGGTCCCAACGTTGTGAATCACTTCTTCTGTGAT
GTTCCTCCTCTTTTGAAGCTTTCATGTTCTGATGCACACATCAATGAGATGCTGCTTTTA
GTCTTCTCTGGAGTGATTGCTATTTTCACTTTCATCATTGTCATGGTGTCCTATATTCAC
ATTATCATTGCCATTCTGAAAATCCGCTCAACTGAGGGGAGGCGTAAAGCCTTCTCCACT
TGCGCCTCACACCTGACAGCTGTGACATTATTTTATGGTTCTGGAACATTTAGTTATATC
CAGCCCAGCTCTCAGTACTCCATGGAACAGGAAAAAGTCTCTGCTGTGTTTTACACCTTG
GTCATCCCTATGTTGAATCCTCTGATTTACAGCCTGAGGAACAAGGATGTGAAGGAAGCA
GCAAAGAAGTTGATTTGTGGGTGGAGTAACACCTCT


Conceptual translation

MDPGNHTVVKEFILLGLTENPDWQIPLFLLFSIIYLIIFVGNWGMIFLIWLNAHLHTPMY
FFLSNLSFCDICYSTVIAPKMLINIVSEHKSSRLLSCVLQSFFFMVYATTEVILLSMMAY
DRYVAIVNPLMYTVIMTFSICISMVLACYLCGIINSLTHTISLLRLDFCGPNVVNHFFCD
VPPLLKLSCSDAHINEMLLLVFSGVIAIFTFIIVMVSYIHIIIAILKIRSTEGRRKAFST
CASHLTAVTLFYGSGTFSYIQPSSQYSMEQEKVSAVFYTLVIPMLNPLIYSLRNKDVKEA
AKKLICGWSNTS