Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5aq6 Olfactory Receptor

Gene Symbol Or5aq6
Organism Rat
Family 5
Subfamily aq
Pseudo No
Location chr3:74700777-74701712 (-)
Aliases Olr541, Olr541

Sequence information


Nucleotide sequence

ATGGATGCAGGAAATCATACAGATGTGAAGGAATTCATACTCCTTGGCTTAACAGAAAAT
CCCAATTGGCAGGTTCCTCTGTTTTTGCTTTTCAGCATAATTTATTTAATCATTTTATTG
GGAAACTGTGGAATGATCTTCTTGATCTGGTTGAACACCCACCTTCATACCCCAATGTAC
TTCTTTCTTAGTAACCTCTCCTTCTGTGACATCTGCTACTCTACTGTTATTGCTCCTAAA
ATGCTTATCAATATCTTATCAGAACACAAATCTAGTAAACTCTTTTCCTGTGTTCTGCAG
AGTTTCTTTTTTATGGTTTATGCAACCACAGAAGTCATTCTACTGTCTATGATGGCTTAT
GATCGTTATGTAGCAATCGCAAACCCCTTAATGTATACAGTTATTATGACATTCAGCATC
TGCATTAATATGGTCCTTGCATGTTACTTATGTGGCCTCATTAATTCCCTGACTCACACA
ATAAGTCTACTGAGACTGTACTTCTGTGGTCCCAACATTGTGAATCATTTCTTCTGTGAC
ATTCCTCCTCTTTTGAAGCTTTCATGCTCTGATGCACACATTAATGAGATGCTACTTTTG
GTCTTCTCTGGAGTGATTGCTATTTTCACTTTCATCATTGTCATGGTGTCCTATATTCAC
ATTATCATTGCCATCCTGAGAATCCGTTCAACTGAGGGGAGGCTCAAAGCTTTCTCCACT
TGTGCCTCACACTTGACAGCTGTGACATTATTTTATGGTTCTGGGTCATTTAGCTATATC
CAGCCAAGCTCTCAGTACTCCATGGAACAGGAAAAAGTCTCTGCTGTGTTTTACACCTTG
GTCATCCCCATGTTGAATCCTCTGATTTACAGCTTGAGGAACAAGGATGTGAAGGAAGCA
GCAATAAGGTTGACTTGTGGATGGAGAAACACTTCT


Conceptual translation

MDAGNHTDVKEFILLGLTENPNWQVPLFLLFSIIYLIILLGNCGMIFLIWLNTHLHTPMY
FFLSNLSFCDICYSTVIAPKMLINILSEHKSSKLFSCVLQSFFFMVYATTEVILLSMMAY
DRYVAIANPLMYTVIMTFSICINMVLACYLCGLINSLTHTISLLRLYFCGPNIVNHFFCD
IPPLLKLSCSDAHINEMLLLVFSGVIAIFTFIIVMVSYIHIIIAILRIRSTEGRLKAFST
CASHLTAVTLFYGSGSFSYIQPSSQYSMEQEKVSAVFYTLVIPMLNPLIYSLRNKDVKEA
AIRLTCGWRNTS