Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5aq6b-ps Olfactory Receptor

Gene Symbol Or5aq6b-ps
Organism Rat
Family 5
Subfamily aq
Pseudo Yes
Location chr3:75,019,400-75,020,200 (-)
Aliases Olr547-ps

Sequence information


Nucleotide sequence

TATTTCATCATTTTTGTGGGTAATTGGGGGATGATCATCTTGATCTGGTTGAACACCCAC
CTTCATACCCCAATGTACTTCTTTCTTAGTAACCTCTCTTTCTGTGACATCTGCTACTCT
ACTGTTATTGCTCCTAAGATGCTCATTAATTTCCTATCAGAACACAAGTCTACTAGGGTG
TTTGCCTGCATTCTGCAGAGTTTCTTTTTTGCAGTTTATGTAACAGTAGAAGTAACCCTC
CTGTCTATGATGGCTTATGATCGCTATGTGGCAATTGTAAACCCCTTAATGTATACAGTT
ATTATGACCTTCAGCATCTGCACTAACCTGGTCCTTGCATGTTACTTTTGTGGCCTCATT
AATTCCCTGACTCACACAATAGGTTTACTCAGACTGGACTTCTGTGGTCCCAACACTGTG
AATCATTTCTTCTGTGACACCCCTCCTCTTTTGAAGTTTTCATGCTCTGATGAACACATC
TATGAGATGCTGCTTTTGGTCTTCTCTGGAGGGATTGCTATTTTCACTTTCATTATTGTC
ATGGTGTCCTATATCCACATTATCATTGCCATCCTGAGAATCAGTTCAACTGAGGGGAGG
TGCAAAGCCTTCTCTACTTGTGCCTCACACTTGACAGCTGTGACATTATTTTATGGTTCT
GGGACATTTAGCTATATCCAGCCAAGCTCTCAGTACTCTATGCAACAGGAAAAGGTCTCT
GCTGTGTTTTATACCTTGGTCATCCCCATGCTGAAACCTCTGATTTACAGCCTGAGGAAC
AATGAGGTGAAGGAAGCAGCAAACAAGTTCACTTGTGGCTGGAGGAGCAACTCT


Conceptual translation

MDSGNHTDVKEFILLGLTDNPSWQVPLFLLFSI/YFIIFVGNWGMIILIWLNTHLHTPM
YFFLSNLSFCDICYSTVIAPKMLINFLSEHKSTRVFACILQSFFFAVYVTVEVTLLSMMA
YDRYVAIVNPLMYTVIMTFSICTNLVLACYFCGLINSLTHTIGLLRLDFCGPNTVNHFFC
DTPPLLKFSCSDEHIYEMLLLVFSGGIAIFTFIIVMVSYIHIIIAILRISSTEGRCKAFS
TCASHLTAVTLFYGSGTFSYIQPSSQYSMQQEKVSAVFYTLVIPMLKPLIYSLRNNEVKE
AANKFTCGWRSNS