Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5aq7 Olfactory Receptor

Gene Symbol Or5aq7
Organism Mouse
Family 5
Subfamily aq
Pseudo No
Location chr2:87107450-87108385 (-)
Aliases Olfr259, RP23-116P4.2, MOR172-3, RP23-116P4.2, MOR172-3

Sequence information


Nucleotide sequence

ATGGGAATTCGGAATCATACAAGTGTGAAAGAATTCATACTGATCGGCTTAACAGAAAAC
CCTAATTGGCAGGTTCCTCTCTTTTTTCTTTTTTGCATAGTTTATTTCATCATTCTTGTG
GGTAATTGGGGGATGATCATTTTGATTTGGTTAAATGCTCAGCTTCATACCCCAATGTAC
TTCTTCCTTAGTAACCTCTCTTTCTGTGACATCTGCTATTCTACAATCATTGCTCCTAAA
ATGCTCATCAATTTTCTATCAGAACACAAGTCTACGAGGCTGTTTGCCTGTATTCTTCAG
AGTTTCTTTTTTGCAGTTTATGTAACCACAGAAGTAATACTCCTGTCTATGATGGCCTAT
GATCGCTATGTGGCAATTGCAAATCCCTTAATGTATACTGTTATCATGACAAACAACATC
TGCACTCAAATGGTACTTGCAAGTTACTTGGGTGGCCTCATAAATTCCATGATTCACACA
ATAGGTTTACTCAAACTAGACTTCTGTGGTCCAAACATTGTGAATCATTTCTTCTGTGAT
GTTCCTCCTCTTTTGAAGCTTGCATGCTCTGATGCACACATCAATGAGATGCTGCTTTTG
GTCTTCTCAGGTGTGTTTGCTATTTCCACTTTCATCATTGTCATGGTGTCCTATATCCAC
ATTATCATTGCCATCCTGAGAATCCGCTCAGCTGAGGGGAGGCGTAAAGCCTTCTCCACT
TGTGCCTCACACCTAACAGCTGTGGCATTATTTTATGGATCTTTGACATTTAACTATATC
CAGCCAAGTTCTCAATACTCCATGGAACAGGAAAAGCTCTCTGCTGTGTTTTACACCTTG
GTCATCCCCATGCTGAACCCTCTGATTTACAGCCTGAGGAACAAGGATGTAAAGGAAGCA
GCCAAGAAGTTAATTTGTGGGGAGAGAAATGCCCCT


Conceptual translation

MGIRNHTSVKEFILIGLTENPNWQVPLFFLFCIVYFIILVGNWGMIILIWLNAQLHTPMY
FFLSNLSFCDICYSTIIAPKMLINFLSEHKSTRLFACILQSFFFAVYVTTEVILLSMMAY
DRYVAIANPLMYTVIMTNNICTQMVLASYLGGLINSMIHTIGLLKLDFCGPNIVNHFFCD
VPPLLKLACSDAHINEMLLLVFSGVFAISTFIIVMVSYIHIIIAILRIRSAEGRRKAFST
CASHLTAVALFYGSLTFNYIQPSSQYSMEQEKLSAVFYTLVIPMLNPLIYSLRNKDVKEA
AKKLICGERNAP