Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5aq7b Olfactory Receptor

Gene Symbol Or5aq7b
Organism Rat
Family 5
Subfamily aq
Pseudo No
Location chr3:75234504-75235439 (-)
Aliases Olr552, Olr552

Sequence information


Nucleotide sequence

ATGGAAGTTTGGAATTCTACAGGTGTGAAAGAATTCATACTGATTGGCTTAACAGAAAAT
CCTAATTGGCAGGTTCCTCTCTTTTTGCTTTTTTGCATAATTTATTTTATCATTCTTGTG
GGTAATTGTGGGATGATCTTCCTGATCTGGTTGAATGTCCAACTTCATACCCCAATGTAC
TTCTTTCTTAGTAACCTCTCCTTCTGTGATATCTGCTATTCCACTATCATTGCTCCTAAA
ATGATCATCAATTTCCTATCAGAACACAAGTCTACTAGGCTGTTTGCTTGTATTCTGCAG
AGTTTCTTTTTTGCAGTATATGCAACCACAGAAGTAGTCCTCCTGTCTATGATGGCTTAT
GATCGCTATGTGGCAATTGCAAACCCCTTAATGTATACAGTTATTATGACACAGAGCATC
TGCACTCAAATGATTCTTGCAAGTTACTTGACTGGCCTCATAAATTCCTTGATTCATACA
ATAGGTTTACTCAAACTAAATTTCTGTGGTCCCAACATTGTGAATCACTTCTTCTGTGAT
GTTCCTCCTCTTTTGAAGCTTGCATGCTCTGATTCACACATCAATGAGATACTGCTCTTA
GTCTTCTCTGGTATAATTGCTATTTCTACTTTGATCATCGTCATAGTATCCTATATCCAC
ATTATCATTGCCATCCTGAGAATCCGCTCCGCTATGGGGAGAGGCAAAGCCTTCTCAACT
TGTGCCTCACACCTGACAGCTGTGGCATTATTTTATGGATCTTTGACATTTAGCTACATC
CAGCCAAGTTCTCAGTACTCCATGGAACAGGAAAAAGTCTCTGCTGTGTTTTACACATTG
GTCATCCCCATGTTGAACCCTCTGATTTACAGCCTGAGAAATAAGGATGTGAAGGAAGCA
GCCCAGAAGTTGATGTTGGGGAAGAGAAATGCCTGT


Conceptual translation

MEVWNSTGVKEFILIGLTENPNWQVPLFLLFCIIYFIILVGNCGMIFLIWLNVQLHTPMY
FFLSNLSFCDICYSTIIAPKMIINFLSEHKSTRLFACILQSFFFAVYATTEVVLLSMMAY
DRYVAIANPLMYTVIMTQSICTQMILASYLTGLINSLIHTIGLLKLNFCGPNIVNHFFCD
VPPLLKLACSDSHINEILLLVFSGIIAISTLIIVIVSYIHIIIAILRIRSAMGRGKAFST
CASHLTAVALFYGSLTFSYIQPSSQYSMEQEKVSAVFYTLVIPMLNPLIYSLRNKDVKEA
AQKLMLGKRNAC