Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5ar1 Olfactory Receptor

Gene Symbol Or5ar1
Organism Mouse
Family 5
Subfamily ar
Pseudo No
Location chr2:85840860-85841789 (-)
Aliases Olfr1019, RP23-384L16.6, MOR180-1, RP23-384L16.6, MOR180-1

Sequence information


Nucleotide sequence

ATGGATAAAGAAAATCACTCAGTTGTGACTGAATTTGTCTTTATGGGCATAACTCAAGAC
CCTCAGCTGCAGATCATCTTTTTTGTGGTCTTCCTCCTTGTCTACCTGGTCAATGTGATA
GGGAATGTTGGTATGATCATCCTGATCATAACAGACAGTCAGCTTCACACCCCCATGTAC
TTTTTCCTCTGCAACCTCTCCTTTGTTGACCTGGGCTACTCATCAGCTATTGCTCCCAGG
ATGCTGGCTGATTTTCTAACAAAGCACAAAGTTATCTCTTTTTCCAGCTGTGCCACCCAG
TTTGCTTTCTTTGTAGGCTTTGTGGATGCTGAGTGCTATGTCCTGGCTGCAATGGCCTAT
GACCGCTTTGTGGCCATCTGCAGACCTCTTCACTATAGCACTCTCATGTCCAAGAAAGTC
TGCTTGGTCCTAATGCTGGGCTCTTACTTCGCTGGCCTAGTGAGTTTAGTGGCGCATACT
TCTCTCACTTTCAGCCTCAGTTACTGTGGTTCCAATATCATCAACCATTTCTTCTGTGAA
ATCCCACCACTCTTAGCTCTCTCTTGCTCAGATACCTACATTAGTGAGATACTGCTGTTT
AGTTTGTGTGGCTTCATTGAGTTCAGCACCATCCTTATCATCTTCATCTCCTATGCCTTC
ATTCTCATTGCCATCATCAGAATTCGATCAGCTGAAGGCCGGCTAAAGGCTTTTTCCACC
TGCGGGTCTCATCTTACTGGTGTTACCCTTTTTTATGGTACAGTCATGTTCATGTATCTG
AGGCCAACATCCAGTTACTCCCTGGACCAAGACAAGTGGGCCTCTGTGTTCTACACAATT
ATCATTCCTATGCTGAACCCCTTGATCTACAGTTTGCGGAACAAGGATGTGAAAGCCGCT
TTCAAGAAACTGATTGGAAAGAAGCCACAA


Conceptual translation

MDKENHSVVTEFVFMGITQDPQLQIIFFVVFLLVYLVNVIGNVGMIILIITDSQLHTPMY
FFLCNLSFVDLGYSSAIAPRMLADFLTKHKVISFSSCATQFAFFVGFVDAECYVLAAMAY
DRFVAICRPLHYSTLMSKKVCLVLMLGSYFAGLVSLVAHTSLTFSLSYCGSNIINHFFCE
IPPLLALSCSDTYISEILLFSLCGFIEFSTILIIFISYAFILIAIIRIRSAEGRLKAFST
CGSHLTGVTLFYGTVMFMYLRPTSSYSLDQDKWASVFYTIIIPMLNPLIYSLRNKDVKAA
FKKLIGKKPQ