Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5ar1 Olfactory Receptor

Gene Symbol Or5ar1
Organism Rat
Family 5
Subfamily ar
Pseudo No
Location chr3:73,225,700-73,226,600 (-)
Aliases Olr462

Sequence information


Nucleotide sequence

ATGCATAAAGAAAATCACTCAGTAGTGACTGAATTTATCTTTATGGGCATCACTCAAGAC
CCTCAGTTGCAGATCATCTTTTTTGTGGTCTTCCTCATTGTCTACCTGGTCAATGTGATA
GGGAATGTTGGCATGATCATCCTGATCATAACAGACAGTCAGCTTCACACTCCCATGTAC
TTTTTTCTCTGCAACCTCTCCTTTGTCGACCTGGGCTACTCATCAGCCATTGCTCCCAGG
ATGCTGGCTGATTGCCTAACAAAGCACAAAGTTATCTCTTTTTCCAGCTGTGCTACCCAA
TTTGCTTTCTTCGTAGGTTTTGTGGATGCTGAATGCTATGTCCTAGCTGCCATGGCCTAT
GACCGCTTCGTGGCCATCTGCAGACCTCTCCACTATAGCACTCTCATGTCCAAAAAAGTC
TGCTTGGTCCTAATGCTGGGCTCTTACTTGGCTGGCCTGGTGAGTTTAGTGGCCCACACA
TCTCTCACTTTCAGCCTCAGTTACTGTGCTTCCAATGTCATCAACCATTTCTTCTGTGAA
ATTCCACCACTCTTGGCTCTCTCTTGCTCAGATACCTACATTAGTGAGATACTGCTCTTT
AGTTTGTGTGGATTCATTGAATTCAGCACCATCCTTATCATCTTCATCTCCTATGCTTTT
ATTCTTATTGCCATCATCAGAATGCGCTCAGCTGAAGGCCGCCTAAAGGCTTTTTCGACC
TGTGGGTCTCATCTTACTGGTGTCACCCTTTTTTATGGTACAGTCATGTTCATGTACCTG
AGGCCAACATCCAGCTACTCCCTGGACCAAGACAAGTGGGCCTCTGTGTTCTACACAATT
ATCATTCCTATGCTGAACCCCTTGATCTACAGTTTGAGGAACAAAGATGTGAAAGCGGCT
TTCAAAAAACTGATTGGAAAGAAACCTCAA


Conceptual translation

MHKENHSVVTEFIFMGITQDPQLQIIFFVVFLIVYLVNVIGNVGMIILIITDSQLHTPMY
FFLCNLSFVDLGYSSAIAPRMLADCLTKHKVISFSSCATQFAFFVGFVDAECYVLAAMAY
DRFVAICRPLHYSTLMSKKVCLVLMLGSYLAGLVSLVAHTSLTFSLSYCASNVINHFFCE
IPPLLALSCSDTYISEILLFSLCGFIEFSTILIIFISYAFILIAIIRMRSAEGRLKAFST
CGSHLTGVTLFYGTVMFMYLRPTSSYSLDQDKWASVFYTIIIPMLNPLIYSLRNKDVKAA
FKKLIGKKPQ