Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5as1 Olfactory Receptor

Gene Symbol Or5as1
Organism Mouse
Family 5
Subfamily as
Pseudo No
Location chr2:87149724-87150659 (-)
Aliases Olfr1111, RP23-116P4.6, MGC123583, MOR181-2, RP23-116P4.6, MGC123583, MOR181-2

Sequence information


Nucleotide sequence

ATGCAGTATACAAACTATACCAAGCCAACAGAGTTTATATTTATCGGATTTACAGATTAC
CAGCCATTAAGACTCATGCTATTTTTGGTGTTTTTCATAGTTTACACCTTAACTTTGGTG
GGAAATATTGGCTTAATAATCCTAGTTAATATTGACTTAAGCCTTCAAACTCCCATGTAT
CACTTTCTTAGCAATCTGTCTTTCTTAGATATCAGCTATTCTACAGCCATTGCACCTAAA
ATGCTGGTAGACTTCTTAGCCTCCAAGAAGAGCATCTCATTCTGTGGATGTGCTATACAG
ATGTTTTTCTTTGCATGCTTTGCAGATGCTGAGTGCCTTATCCTGGCTGCAATGGCATAC
GACCGCTATGCAGCCATTTGCAACCCACTGCTTTACTCTACATTGGTGTCTCGAAGGGTC
TGCTTCAGCTTTGTTGTGTTGGCTTATTTTAGCGGAAGCGTGACCTCACTGGTGCATGTA
TCCCTTGCATTTATGCTTCCATACTGTAGGTCCAATATTGTCAACCACTTTTTTTGTGAT
ATCCCACCTCTCCTTGCTTTATCATGTGCAGATACTCATATTAATGAGCTTCTGCTCTTT
GCTTTATGTGGTACAATCCAGACCAGCACTTTCATGGTCATCCTTATTTCTTACTCTTGC
ATCCTCATTACTGTTTTGAGCATCAAGTCCACAGGAGGCAGGAGCAAAACATTTTCCACT
TGTGCTTCTCATCTCATAGCAGTCACCTTGTTCTATGGAACACTGCTGTTTATGTACTTG
CGTCCCACCACTAGCTATTCCCCAGACACTGATAAGGTAGTTGCTTTGTTTTACACTGTT
GTATTTCCTATGTTGAATCCAATAATTTACAGCTTCAGAAATAAGGATGTGAAAAATGCA
TTAAAAAAATTGTTTGATAGACTGGGGATCTTCAGA


Conceptual translation

MQYTNYTKPTEFIFIGFTDYQPLRLMLFLVFFIVYTLTLVGNIGLIILVNIDLSLQTPMY
HFLSNLSFLDISYSTAIAPKMLVDFLASKKSISFCGCAIQMFFFACFADAECLILAAMAY
DRYAAICNPLLYSTLVSRRVCFSFVVLAYFSGSVTSLVHVSLAFMLPYCRSNIVNHFFCD
IPPLLALSCADTHINELLLFALCGTIQTSTFMVILISYSCILITVLSIKSTGGRSKTFST
CASHLIAVTLFYGTLLFMYLRPTTSYSPDTDKVVALFYTVVFPMLNPIIYSFRNKDVKNA
LKKLFDRLGIFR