Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5as1 Olfactory Receptor

Gene Symbol Or5as1
Organism Rat
Family 5
Subfamily as
Pseudo No
Location chr3:74867640-74868575 (-)
Aliases Olr544, Olr544

Sequence information


Nucleotide sequence

ATGCAGTACACGAACTATACCAAGCCAACAGAGTTTATATTTATCGGATTCACAGATTAT
CTGCCGTTAAGACTCATGCTATTTTTAGTGTTTCTCATAGTTTACATATTAACTTTGGTG
GGAAATATGGGCTTAATAATCCTAGTCAATATTGACTTAAGTCTTCAAACCCCTATGTAT
CACTTTCTTAGCAATCTGTCTTTCTTAGATATCAGCTATTCAACAGCTATTGCACCTAAA
ATGCTGGTAGACTTCTTAGCCTCCAAGAAGAGTATCTCATTTTATGGATGTGCTATACAG
ATGTTTTTCTTTGCATGCTTTGCAGACGCGGAGTGCCTTATCCTGGCTGCGATGGCATAT
GACCGCTATGCAGCCATTTGCAACCCACTGCTTTATTCTACATTGGTGTCTCGCAAGGTC
TCCTTCAGCCTTGTTGTATTGGCTTATTTTAGTGGAAGTGTGACCTCACTGGTGCATGTG
TCACTCACGTTTATGCTTCCATACTGTAGGTCCAATATTGTCAACCATTTTTTTTGTGAC
ATCCCACCTCTCCTTGCATTATCGTGTGCTGATACTCATATTAATGAGCTTCTGCTCTTT
GCTTTATGTGGCACAATCCAGACCAGCACTTTCATGGTCATCCTTACTTCTTACGTCTGC
ATCCTCATTACTGTTTTGAGCATCAAGTCCTCAGGAGGCAGGAGCAAAACATTCTCCACC
TGTGCTTCTCATCTCATAGCTGTCACCTTGTTCTATGGAACACTGCTCTTTATGTACTTG
CGTCCCACCACCAGCTATTTCCCAGACACTGATAAGGTAGTTGCTCTGTTTTACACTGTT
CTGTTTCCTATGTTGAATCCAATTATTTACAGCTTTAGAAACAAAGATGTGAAAAATGCA
CTCAAAAAATTGTTTGATAAACAAGGGACCTTCAGG


Conceptual translation

MQYTNYTKPTEFIFIGFTDYLPLRLMLFLVFLIVYILTLVGNMGLIILVNIDLSLQTPMY
HFLSNLSFLDISYSTAIAPKMLVDFLASKKSISFYGCAIQMFFFACFADAECLILAAMAY
DRYAAICNPLLYSTLVSRKVSFSLVVLAYFSGSVTSLVHVSLTFMLPYCRSNIVNHFFCD
IPPLLALSCADTHINELLLFALCGTIQTSTFMVILTSYVCILITVLSIKSSGGRSKTFST
CASHLIAVTLFYGTLLFMYLRPTTSYFPDTDKVVALFYTVLFPMLNPIIYSFRNKDVKNA
LKKLFDKQGTFR