Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5as2-ps Olfactory Receptor

Gene Symbol Or5as2-ps
Organism Rat
Family 5
Subfamily as
Pseudo Yes
Location chr3:74,932,300-74,932,900 (-)
Aliases Olr549-ps

Sequence information


Nucleotide sequence

ATGCAGTACACGAACTATACCAAGCCAACAGAGTTTATATTTATCGGATTCACAGATTAT
CTGCCATTAAGACTCATGCTATTTTTAGTGTTTCTCATAGTTTACACATTAACTTTGGTG
GGAAATATGGGTTTAATAATCCTAGTCAATATTGACTTAAGTCTTCAAACCCCTATGTAT
CACTTTCTTAGCAATCTGTCTTTCTTAGATATCAGCTATTCAACAGCTATTGCACCTAAA
ATGCTGGTAGACTTCTTAGCCTCCAAGAAGAGTATCTCATTTTATGGTTGTGCTGTACAG
ATGTTtttctttgcatgctttgcagacgcggccttgcgcttcctaggcaagtgctctacc
actgagctaaatccccgaccccTCATCCTTACTTCTTACGTCTGCATCCTCATTACTGTT
TTGGGCATCAAGTCCTCAGGAGGCAGGAGCAAAACATTCTCCACCTATGTTTCTCATCTC
ATAGCTGTCACCTTGTTCTATGGAACACTGCTCTTTATGTACTTGCATCCAACCACCAGC
TATTCCCCAGACACTGATAAGGTAGTTGCTCTGTTTTACACTGTTGTGTTTCCTATGTTG
AATCCAATTATTTACAGCTTTAGAAACAAAGATGTGAAAAACGCCCTCAAAAAATTATTT
GATAAACAA


Conceptual translation

MQYTNYTKPTEFIFIGFTDYLPLRLMLFLVFLIVYTLTLVGNMGLIILVNIDLSLQTPMY
HFLSNLSFLDISYSTAIAPKMLVDFLASKKSISFYGCAVQMFFFACFADAALRFLGKCST
TELNPRPLILTSYVCILITVLGIKSSGGRSKTFSTYVSHLIAVTLFYGTLLFMYLHPTTS
YSPDTDKVVALFYTVVFPMLNPIIYSFRNKDVKNALKKLFDKQ