Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5ay1-ps Olfactory Receptor

Gene Symbol Or5ay1-ps
Organism Rat
Family 5
Subfamily ay
Pseudo Yes
Location chr1:230192323-230193396 (+)
Aliases Olr362-ps, Olr362-ps

Sequence information


Nucleotide sequence

CTGGCTTTCTTTGAGTAAGCTCAAATTGCAAATCTTAACTCAGTGGTTTCTATACTCTTT
TCAATCACCTTTTCTTGTTCTCATGGTCCCAGAACATCCAATGATCTCCAGTAACCTGGA
TAGAGAACAAGACAGAAGTAAAACATTCCTGATAGGATTCACCAATGTGCCAGTCCTACA
CCTTCCCCTCATTATAACTATCTTCTGATATACATTATCATCCTGGTGGGAAAACTGAGG
GATGATCCTGTTGATTTTTCTGTACTCTCAGCTTTACACCTCCAATGAACTTTTATTTTA
ATCTAACCTGTCTCTTTTTGAACCTTAACTATATTCAAATGTTACACCAAAAGTGATTGC
TGAGCTTTTTACTTGAAACAATGTCATGTCCTACAATTGCTGTGCTACTCAGGTTTTCTG
TTTCATTGTCTTTGACAGTGTAGAAAATTAGTTGTTAGTCTCAAAGGCACACAAATGCTA
TGTATGCCACCATCATGACAACAGGGGTGTGCATATGGCTGTTCATAAGCTGCTATGCTT
TAGGACTTTTAAATGCTTCCACCTACACTAGAGTTGTATTCACTCTCTCTGTGAGCACAG
TGTGATCCATCATATATTTTTTGATATTCCAGGAGTCATGGTTCCCTTTTGCTCTGATGT
GCATATTGATGTGCTAATTCTTGATATGTAGTAAGTTTTCATATCCTTTGGATATCATAG
CCGTGTTGATATCTTACATATTTAGTTTTATTACTCTCCTAAGAATGTACACAGTTGATG
GACATGACAAGGCTATTTCTACCTGTGCCTCCCACTTCACTACAATACCTATTTTCTAGG
AATTGTCATCTCTTTGTATTTGCAGCTCAGCTCCAGTTATTCAACTGACACAGACAAGAT
TGCATCTGGTTATACATTATGTTTTTCATCATGCTGAAGACTGTGGTGTACATTCTGAGG
AACAAGGAGGATAAGAGTATATTTTAAAACTAAAGAATGTATATACTTTTGAAGAGAAAA
AACATTTAGGAATATTTCATTTCTACACTATTTGTAATCCTCAGCAATAATTCA


Conceptual translation

LIGFTNVPVLHLPLII/YLLIYIIILVG\*GMILLIFLYSQLYTSNELLF*SNLSLFE
P*LYSNVTPKVIAELFT*NNVMSYNCCATQVFCFIVFDSVEN*LLVSKAHKC\YATIMT
TGVCIWLFISCYALGLLNASTYTRVVFTL/CEHSVIHHIFFDIPGVMVPFCSDVHIDVL
ILD/VVSFHIL/DIIAVLISYIFSFITLLRMYTVDGHDKAISTCASHFTTIPIF/GI
VISLYLQLSSSYSTDTDKIAS/LYIMFFIMLKTVVYILRNKE