Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5b100-ps Olfactory Receptor

Gene Symbol Or5b100-ps
Organism Mouse
Family 5
Subfamily b
Pseudo Yes
Location chr19:13016225-13017146 (+)
Aliases Olfr1452-ps1, MOR202-23

Sequence information


Nucleotide sequence

ATGGAGAACAAGACAGAAGTGACACAGTTCTTCCTGCAGGGACTTGCCAGTGACCCAGGC
CTACAGCTTCCTCTCTTTATCATCTTTCTCCTCATCTACACCATCACTCTGGTGGGCAAC
CTGGGAATGATCCTGCTGATTGTCCTTGATGCTCACCTTCACAGTCCCATGTATATTTTT
CTTGGTAATCTATCACTGGTGGACTTTTGTTACTCTTCAGGTGTCACTCCAAAAGTCATG
GCTGGTTTTCTAGTAGGAGATAAAGTCATGTCGTATAATGACTGTGCTGCTCAGATGTTT
TTTGTTACAGGCTTTGCTACTGTGGAAAATTACCTGTTGGCCTCAATGGCTTATGATCGC
TATGCAGCAGTGTGTAAGCCCCTACACTATGCTAGCACCATGACTACAAGTATGTGTATA
TGGATGATCGCAGGTTGCTATGCCTGTGGCTTTCTGAATGCCTGTATCTATACCGGGGAT
GCATTTAGTTTATCTTTCTGTAAGGCTGATGTGGTCCATCATTTTTTCTGTGATATTCCA
GCAGTCATGGTACTCTCTTGCTCCAATAAACATATAAATGAGCTGGTTCTTGTTTGTGTA
GCCAGTTTCAATATTTTTTTTTGCTCTCATAATCATCTTAATATCCTACCTAATGATTTT
TATCACAATTATAAAGATGCACTCAGCTTCAGGACATCAAAAGGCCATGTCCACCTGTGC
TTCTCATTTCACTGCTGTTTTTATTTTCTATGGGACAGTAATTTTCATGTACTTGCAGCC
TAGTTCCAGTCATGCTATGGACACTGACAAAACTGTGTCTGTGTTCTATACCATGGTGAT
CCCCCTGCTGAACCCTCTGGTGTACAGCTTGAGGAACAAGGAAGTCAAGAGTGCATTCAG
AAAAATTATTTTCAGGCCAAAA


Conceptual translation

MENKTEVTQFFLQGLASDPGLQLPLFIIFLLIYTITLVGNLGMILLIVLDAHLHSPMYIF
LGNLSLVDFCYSSGVTPKVMAGFLVGDKVMSYNDCAAQMFFVTGFATVENYLLASMAYDR
YAAVCKPLHYASTMTTSMCIWMIAGCYACGFLNACIYTGDAFSLSFCKADVVHHFFCDIP
AVMVLSCSNKHINELVLVCVASFNIFFCS\IILISYLMIFITIIKMHSASGHQKAMSTC
ASHFTAVFIFYGTVIFMYLQPSSSHAMDTDKTVSVFYTMVIPLLNPLVYSLRNKEVKSAF
RKIIFRPK