Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5b100 Olfactory Receptor

Gene Symbol Or5b100
Organism Rat
Family 5
Subfamily b
Pseudo No
Location chr1:229877560-229878480 (+)
Aliases Olr347, Olr347

Sequence information


Nucleotide sequence

ATGGAGAACAGGACAGAAGTGACACAGTTCTTCCTGCTGGGACTTACAAATGACCCAGGT
CTACAGCATCCTCTCTTTATCATCTTTCTTCTCATCTACACCATCACTCTGGTCGGAAAC
CTGGGATTGATTCTACTGATTGTCCTTGATGCTCACCTCCACAGTCCCATGTATATTTTT
CTTGGTAATTTATCACTGGTGGACTTCTGTTACTCTTCAGGTGTCACTCCAAAAGTCATG
GCTGGCTTTCTAGTAGGAGATAAAGTCATGTACTATAATGACTGTGCTGCTCAGATGTTC
TTTGTTACAGGCTTTGCTACTGTAGAAAATTACCTGTTAGCTTCAATGGCCTATGATCGC
TATGCAGCAGTGTGTAAGCCCCTACACTATGCTAGCACCATGACTACAGGTATGTGTGTG
TGGATGATTGCAGGCTGTTATGCCTGTGGCTTCCTGAATGCATGTATCTATACTGGCGAT
GCATTTAGTCTCTCCTTCTGTAGGGCTGATGTAGTCCATCATTTTTTCTGTGATATTCCA
GCAGTCATGGTACTCTCTTGTTCTGATAATCACGTGAATGAGCTGCTTCTTGTTTGTGTA
GCCAGCTTCAATATATTTTTTGCTCTTATAATCATCATAATATCCTACCTAATGATTTTT
ATCACAATTCTAAAGATGCGTTCAGCTGCAGGACATCAGAAGGCCATGTCCACCTGTATA
TCTCATTTCACTGCTGTTTTTATTTTCTATGGGACAGTAATTTTCATGTACTTGCAGCCT
AGTTCGAGTCATGCCATGGACACTGACAAAACTGTGTCTGTGTTTTATACCATGGTGATC
CCCCTGTTGAACCCTTTGGTCTATAGTTTGAGGAACAAGGAAGTCAAGAGTGCGTTCAGA
AAGTTTATTTTCAGGTTAAAA


Conceptual translation

MENRTEVTQFFLLGLTNDPGLQHPLFIIFLLIYTITLVGNLGLILLIVLDAHLHSPMYIF
LGNLSLVDFCYSSGVTPKVMAGFLVGDKVMYYNDCAAQMFFVTGFATVENYLLASMAYDR
YAAVCKPLHYASTMTTGMCVWMIAGCYACGFLNACIYTGDAFSLSFCRADVVHHFFCDIP
AVMVLSCSDNHVNELLLVCVASFNIFFALIIIIISYLMIFITILKMRSAAGHQKAMSTCI
SHFTAVFIFYGTVIFMYLQPSSSHAMDTDKTVSVFYTMVIPLLNPLVYSLRNKEVKSAFR
KFIFRLK