Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5b102 Olfactory Receptor

Gene Symbol Or5b102
Organism Rat
Family 5
Subfamily b
Pseudo No
Location chr1:229889771-229890691 (+)
Aliases Olr348, Olr348

Sequence information


Nucleotide sequence

ATGGAAAACAGGACAGAAGTGAGATACTTCGTCCTGGTGGGACTCACCAATGACCCAGAC
CTGCAGCTTCCCCTCTTCATCACCTTTTTCCTGATCTACACCATCACCATTATTGGAAAT
ATGGGGCTGATCCTTTTGATTCTTTCAGACTCTCGGCTTCACACCCCCATGTACATTTTC
CTAGGTAATCTGTCTTTAGTGGACTTCTGTTACTCTTCAACAGTAACTCCAAATGTCATA
GCTGGATTCCTTACAGGAGACAAGATCATGTCTTACAATGCTTGTGCCTCTCAGATGTTC
TTTTTTGCAAACTTTGCTGATGTGGAAAACTACCTTTTAGTCTCAATGGCGTATGATCGT
TATGTAGCAGTATGTAAGCCCCTACACTATGCCACCACCATGACGACACGTGTATGTGTA
TGTATAGTCATTGGCTGTTATATCTGTGGTTTCCTGAATGCTTCCATCTATACTGTGAAT
GCATTCAGTCTCTCCTTCTGTGAATCCAATGTGGTCCACCATTTTTTCTGTGATGTTTTA
GCAGTCATGATTGTATCTTGCTCTGATAGACACGTTAATGAACTTACTTTTGTTTATGTA
GCCAGCTTCAATATATTTTTTGCCCTTATACTCATCTTAATATCCTACATGTTCATTTTT
ACTAGCATACTAAAGATGCATTCAGCTGCAGGATATCAAAAAGCTCTCTCCACATTTGCT
TCACACTTCACAGCTGTCTCCATTTTCTATGGGACAATCATATTTATGTACCTGCAGCCC
AGCTCGAGTCAATCTATGGACACTGACAAAATTGCATCTGTGTTCTATGTTATGATTATC
CCCATGTTGAATCCTCTGGTTTACAGCCTGAGGAACAGGGATGTGAAAAGTGCTTTCACA
AAGATTATATTGAGGTCAAGA


Conceptual translation

MENRTEVRYFVLVGLTNDPDLQLPLFITFFLIYTITIIGNMGLILLILSDSRLHTPMYIF
LGNLSLVDFCYSSTVTPNVIAGFLTGDKIMSYNACASQMFFFANFADVENYLLVSMAYDR
YVAVCKPLHYATTMTTRVCVCIVIGCYICGFLNASIYTVNAFSLSFCESNVVHHFFCDVL
AVMIVSCSDRHVNELTFVYVASFNIFFALILILISYMFIFTSILKMHSAAGYQKALSTFA
SHFTAVSIFYGTIIFMYLQPSSSQSMDTDKIASVFYVMIIPMLNPLVYSLRNRDVKSAFT
KIILRSR