Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5b103-ps Olfactory Receptor

Gene Symbol Or5b103-ps
Organism Mouse
Family 5
Subfamily b
Pseudo Yes
Location chr19:13068886-13069674 (+)
Aliases Olfr1455-ps1

Sequence information


Nucleotide sequence

ATCATTGGACAGAACTCTAGGCTCCACAGTCCAATGTACATTTTCCTTGGTAATCTATCA
CTGGTAGACTTTTGTTATTCTTCAGCTGTTTACCCCAACAGTGATGTCTGAGTTTCTTAT
TGGTAACAATGTCATGTCCTACAATGACTGTGCTGCTCAGATGGTCTGTTTCACTTCTTT
TGCCAGTGTGGAAAATTACCTGTTAGCCTCAATGGCATATGATTGCTATGCAGCAGTGTG
TAAGCCTCTGCACTACACCACCACCCTGACTATGGGTGTGTGCATCTGGCTAGTCATAGG
CTGCTATGTTCTAGGTTTTCTAAGTGCCTCCATCTATACTGGAGAGACATTCGGCCTATC
TTTCTGTGAGACCAATGTGGTCCATCATTTCTGTTGTGATATTCCTGCAGTCATGGTTCT
CTCTTGTTCTGATAGGCGTATTAATGAGATGATTTTGGTTTATGTAGTGTGTTTCAATAT
ATTTTTGCTATCATAGTCATATGGATATCTTACATATTCATTTTTATTACTATCCTAAGA
ATGCAAACAGCTGCTGGACATTGGAAGGCTGTTTCCACCTGTGCCTCCCACTTCACTGCA
GTTTCCATTTTCTATGGAATTGTCATCTTCATGTATTTGCAATCCAGCTCCAGTCATTCC
ATGGACAAAGACAAAATTGCATCTGTGTTCTACACTATGGTAATCCCCATGCTGAACCCT
ATGGTGTACAGTCTGAGGAACAAGGAAGTCAAGAGTGCATTATTAAAGTTAAAGAATGCA
TTTACATTT


Conceptual translation

IIGQNSRLHSPMYIFLGNLSLVDFCYSSAVYPN\MSEFLIGNNVMSYNDCAAQMVCFTS
FASVENYLLASMAYDCYAAVCKPLHYTTTLTMGVCIWLVIGCYVLGFLSASIYTGETFGL
SFCETNVVHHFCCDIPAVMVLSCSDRRINEMILVYVVCFNI/FAIIVIWISYIFIFITI
LRMQTAAGHWKAVSTCASHFTAVSIFYGIVIFMYLQSSSSHSMDKDKIASVFYTMVIPML
NPMVYSLRNKEVKSALLKLKNAFTF